| Basic Information | |
|---|---|
| Taxon OID | 3300010931 Open in IMG/M |
| Scaffold ID | Ga0137937_1004236 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_U1383E_lower_OATZ |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2343 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pond, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 22.8 | Long. (o) | -46.05 | Alt. (m) | Depth (m) | 4425 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006329 | Metagenome / Metatranscriptome | 376 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0137937_10042365 | F006329 | AGAAG | LKEKIKKIEEEKMILELHVADVVDDHKIKMEKMSLKIRKIRKYAIDSEAWYHYDVGSIVTLVANLIAFVVAFKFFKSIIIL* |
| ⦗Top⦘ |