Scaffold Ga0138112_1081759

Overview

Basic Information

• Taxon OID: 3300010905
• Scaffold ID: Ga0138112_1081759
• Source Dataset Name: Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_8_1 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Angelo Coastal Reserve, California
• Coordinates
  • Lat. (^o): 39.7181
  • Long. (^o): -123.6527
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055610	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138112_10817591	F055610	N/A	GEGKMFGIELAGGAWIFLAVILIWTVSIIYGLYTRSGSGINQRPHANAYTNAPGARIPSTLSHDESAATRYTRGTR*