Basic Information | |
---|---|
Taxon OID | 3300010430 Open in IMG/M |
Scaffold ID | Ga0118733_100076163 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6854 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (11.11%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Coast | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104987 | Metagenome / Metatranscriptome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118733_1000761639 | F104987 | N/A | MDKEKELKWGTIIPLIGGSAIGCNKATGNLPAFHLSYEAFAANESHIEDYWPEVPMYRLDHEE |
⦗Top⦘ |