| Basic Information | |
|---|---|
| Taxon OID | 3300010411 Open in IMG/M |
| Scaffold ID | Ga0136993_10016539 Open in IMG/M |
| Source Dataset Name | Aquatic microbial communities from North Sea petroleum storage tank - Cell3b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1797 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Sea | |||||||
| Coordinates | Lat. (o) | 60.9 | Long. (o) | 1.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026738 | Metagenome / Metatranscriptome | 197 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136993_100165393 | F026738 | AGGAGG | MADRATTLSGRFQKVTLGGSDSKVLGAGTYTISGATRRTADASEFGVDVDIFEFGSADGGTITLSDVSFDPTDPAQNTLRTNVENAIKLINSSTSGIRFWINSTSFYTIGTSGHILLTKGGAVRADRNGLAKTDYEGQISGAFMYLAESIV* |
| ⦗Top⦘ |