Scaffold Ga0134127_11177168

Overview

Basic Information

• Taxon OID: 3300010399
• Scaffold ID: Ga0134127_11177168
• Source Dataset Name: Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 833
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Kellog Biological Station, Michigan
• Coordinates
  • Lat. (^o): 42.3938
  • Long. (^o): -85.3708

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079309	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134127_111771681	F079309	N/A	TDALSLCELFANADAARYERAALRWLQRFIDERLPPLIEVTLAASALAELRHGNRNAGIEALKRLLRSG*