Scaffold Ga0136809_1148455

Overview

Basic Information

• Taxon OID: 3300010385
• Scaffold ID: Ga0136809_1148455
• Source Dataset Name: Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA . Combined Assembly of Gp0155292, Gp0155293
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Leibniz Institute
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1138
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated → Giant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa

Source Dataset Sampling Location

• Location Name: Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.619
  • Long. (^o): -121.9
  • Depth (m): 6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084839	Metagenome / Metatranscriptome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136809_11484552	F084839	N/A	MNRPYKYITVLDYSNGQVYLYDYDETEMPNAADFVKSRHDLDDVNYMVHQYKPALWTKDVYYCTKEQAYQLTNED*