| Basic Information | |
|---|---|
| Taxon OID | 3300010385 Open in IMG/M |
| Scaffold ID | Ga0136809_1012310 Open in IMG/M |
| Source Dataset Name | Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA . Combined Assembly of Gp0155292, Gp0155293 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Leibniz Institute |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4490 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (30.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated → Giant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.619 | Long. (o) | -121.9 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002549 | Metagenome / Metatranscriptome | 549 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136809_10123103 | F002549 | N/A | MSKLLKLLGGSAAPLLDKAAEVADRFIDTPAEKKAFIKEAYQQEVLDRKEARELGKNKSTPDILTYVTLFIAIGLATAIFTDFLDWAALTEVQKGLITTFSGFFLRTLGDVYGYWFGSSMGSGDKTKDLTKLMRK* |
| ⦗Top⦘ |