| Basic Information | |
|---|---|
| Taxon OID | 3300010381 Open in IMG/M |
| Scaffold ID | Ga0136547_111244 Open in IMG/M |
| Source Dataset Name | Methanogenic microbial communities from bioreactors in Yantai Institute of Oceanology, CAS, Yantai, China ? reactor 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 719 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → unclassified Marinilabiliaceae → Marinilabiliaceae bacterium JC017 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Bioreactor → Methanogenic Microbial Communities From Bioreactors In Yantai Institute Of Oceanology, Cas, Yantai, China |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yantai academy of sciences oceanology institute, Yantai, China | |||||||
| Coordinates | Lat. (o) | 37.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017253 | Metagenome | 242 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136547_1112441 | F017253 | N/A | MRANVGSYTQGRTAGNFLSSRKAAWTERCPPKTTAAALDG* |
| ⦗Top⦘ |