Basic Information | |
---|---|
Taxon OID | 3300010378 Open in IMG/M |
Scaffold ID | Ga0126330_10089000 Open in IMG/M |
Source Dataset Name | Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1678 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hawaii, USA | |||||||
Coordinates | Lat. (o) | 21.3935 | Long. (o) | -157.7156 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075532 | Metagenome | 118 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126330_100890002 | F075532 | N/A | SEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGEHTTCV* |
⦗Top⦘ |