Metagenome Family F075532

Basic Information
Family ID	F075532
Family Type	Metagenome
Number of Sequences	118
Average Sequence Length	41 residues
Representative Sequence	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS
Number of Associated Samples	11
Number of Associated Scaffolds	118

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	29.31 %
% of genes near scaffold ends (potentially truncated)	63.56 %
% of genes from short scaffolds (< 2000 bps)	80.51 %
Associated GOLD sequencing projects	11
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Unclassified (69.492 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms (100.000 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 33.33% Coil/Unstructured: 66.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF00035	dsrm	0.85
PF00240	ubiquitin	0.85
PF13246	Cation_ATPase	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
All Organisms	root	All Organisms	30.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
cellular organisms	root	All Organisms → cellular organisms	30.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	24.58 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	24.58 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	24.58 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.08 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	24.58 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	5.08 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	24.58 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	5.08 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	24.58 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	4.24 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	24.58 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	2.54 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.69 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	24.58 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	2.54 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.69 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	24.58 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.69 %
Annelida	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida	1.69 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Clitellata	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata	1.69 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.85 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Hirudinea	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea	1.69 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.85 %
Arachnida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Rhynchobdellida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida	1.69 %
Acari	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari	0.85 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Glossiphoniidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae	1.69 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.85 %
Parasitiformes	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella	1.69 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.85 %
Ixodida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Ixodoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea	0.85 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Amphiesmenoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Lepidoptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Glossata	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Neolepidoptera	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Heteroneura	parvorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Ditrysia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Gelechioidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Gelechioidea	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Gelechiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Gelechioidea → Gelechiidae	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Apatetrinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Gelechioidea → Gelechiidae → Apatetrinae	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Pectinophora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Gelechioidea → Gelechiidae → Apatetrinae → Pectinophora	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	69.49 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	24.58 %
Helobdella robusta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1.69 %
Pectinophora gossypiella	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Gelechioidea → Gelechiidae → Apatetrinae → Pectinophora → Pectinophora gossypiella	0.85 %
Ixodidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	0.85 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.85 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300010290\|Ga0126333_1007105	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	4144	Open in IMG/M
3300010290\|Ga0126333_1019482	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3039	Open in IMG/M
3300010290\|Ga0126333_1021388	Not Available	2939	Open in IMG/M
3300010290\|Ga0126333_1042288	Not Available	2252	Open in IMG/M
3300010290\|Ga0126333_1046489	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2161	Open in IMG/M
3300010290\|Ga0126333_1100059	Not Available	1463	Open in IMG/M
3300010290\|Ga0126333_1108269	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Amphiesmenoptera → Lepidoptera → Glossata → Neolepidoptera → Heteroneura → Ditrysia → Gelechioidea → Gelechiidae → Apatetrinae → Pectinophora → Pectinophora gossypiella	1395	Open in IMG/M
3300010290\|Ga0126333_1160521	Not Available	1072	Open in IMG/M
3300010290\|Ga0126333_1175839	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	1001	Open in IMG/M
3300010290\|Ga0126333_1225611	Not Available	817	Open in IMG/M
3300010290\|Ga0126333_1275476	Not Available	681	Open in IMG/M
3300010290\|Ga0126333_1307935	Not Available	611	Open in IMG/M
3300010290\|Ga0126333_1318424	Not Available	591	Open in IMG/M
3300010290\|Ga0126333_1332474	Not Available	565	Open in IMG/M
3300010290\|Ga0126333_1337748	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	556	Open in IMG/M
3300010292\|Ga0126326_1035987	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	2332	Open in IMG/M
3300010292\|Ga0126326_1042317	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2181	Open in IMG/M
3300010292\|Ga0126326_1075094	Not Available	1677	Open in IMG/M
3300010292\|Ga0126326_1103537	Not Available	1413	Open in IMG/M
3300010292\|Ga0126326_1186921	Not Available	970	Open in IMG/M
3300010292\|Ga0126326_1225316	Not Available	842	Open in IMG/M
3300010292\|Ga0126326_1264504	Not Available	737	Open in IMG/M
3300010292\|Ga0126326_1270979	Not Available	722	Open in IMG/M
3300010292\|Ga0126326_1322880	Not Available	617	Open in IMG/M
3300010292\|Ga0126326_1324295	Not Available	615	Open in IMG/M
3300010292\|Ga0126326_1366913	Not Available	548	Open in IMG/M
3300010294\|Ga0126332_10010405	Not Available	4448	Open in IMG/M
3300010294\|Ga0126332_10010553	Not Available	4425	Open in IMG/M
3300010294\|Ga0126332_10189733	Not Available	1050	Open in IMG/M
3300010294\|Ga0126332_10273273	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	761	Open in IMG/M
3300010294\|Ga0126332_10292239	Not Available	714	Open in IMG/M
3300010294\|Ga0126332_10298317	Not Available	700	Open in IMG/M
3300010294\|Ga0126332_10341040	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	615	Open in IMG/M
3300010294\|Ga0126332_10344663	Not Available	609	Open in IMG/M
3300010294\|Ga0126332_10351190	Not Available	598	Open in IMG/M
3300010295\|Ga0126334_10055109	Not Available	2170	Open in IMG/M
3300010295\|Ga0126334_10231500	Not Available	884	Open in IMG/M
3300010295\|Ga0126334_10254542	Not Available	815	Open in IMG/M
3300010295\|Ga0126334_10405431	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	536	Open in IMG/M
3300010295\|Ga0126334_10410320	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	531	Open in IMG/M
3300010295\|Ga0126334_10418060	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	522	Open in IMG/M
3300010298\|Ga0126325_10025148	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2911	Open in IMG/M
3300010298\|Ga0126325_10033523	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Clitellata → Hirudinea → Rhynchobdellida → Glossiphoniidae → Helobdella → Helobdella robusta	2603	Open in IMG/M
3300010298\|Ga0126325_10038011	Not Available	2475	Open in IMG/M
3300010298\|Ga0126325_10056746	Not Available	2078	Open in IMG/M
3300010298\|Ga0126325_10085605	Not Available	1698	Open in IMG/M
3300010298\|Ga0126325_10203809	Not Available	999	Open in IMG/M
3300010298\|Ga0126325_10220926	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	941	Open in IMG/M
3300010298\|Ga0126325_10225369	Not Available	928	Open in IMG/M
3300010298\|Ga0126325_10272028	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	802	Open in IMG/M
3300010298\|Ga0126325_10325586	Not Available	693	Open in IMG/M
3300010298\|Ga0126325_10347274	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	657	Open in IMG/M
3300010298\|Ga0126325_10399115	Not Available	586	Open in IMG/M
3300010298\|Ga0126325_10411004	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	572	Open in IMG/M
3300010298\|Ga0126325_10434917	Not Available	546	Open in IMG/M
3300010298\|Ga0126325_10449408	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	532	Open in IMG/M
3300010298\|Ga0126325_10462909	Not Available	519	Open in IMG/M
3300010314\|Ga0126331_1181823	Not Available	991	Open in IMG/M
3300010314\|Ga0126331_1292141	Not Available	643	Open in IMG/M
3300010314\|Ga0126331_1320340	Not Available	585	Open in IMG/M
3300010314\|Ga0126331_1361332	Not Available	516	Open in IMG/M
3300010314\|Ga0126331_1369255	Not Available	505	Open in IMG/M
3300010315\|Ga0136654_1025669	Not Available	2904	Open in IMG/M
3300010315\|Ga0136654_1081301	Not Available	1721	Open in IMG/M
3300010315\|Ga0136654_1093297	Not Available	1592	Open in IMG/M
3300010315\|Ga0136654_1122898	Not Available	1344	Open in IMG/M
3300010315\|Ga0136654_1252036	Not Available	770	Open in IMG/M
3300010315\|Ga0136654_1267110	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	729	Open in IMG/M
3300010315\|Ga0136654_1275542	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Ixodida → Ixodoidea → Ixodidae	708	Open in IMG/M
3300010315\|Ga0136654_1333959	Not Available	585	Open in IMG/M
3300010315\|Ga0136654_1367015	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	532	Open in IMG/M
3300010377\|Ga0126328_10020177	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	3216	Open in IMG/M
3300010377\|Ga0126328_10028500	Not Available	2830	Open in IMG/M
3300010377\|Ga0126328_10079400	Not Available	1786	Open in IMG/M
3300010377\|Ga0126328_10139844	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1276	Open in IMG/M
3300010377\|Ga0126328_10166014	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1130	Open in IMG/M
3300010377\|Ga0126328_10192382	Not Available	1013	Open in IMG/M
3300010377\|Ga0126328_10331336	Not Available	630	Open in IMG/M
3300010377\|Ga0126328_10339112	Not Available	616	Open in IMG/M
3300010377\|Ga0126328_10348401	Not Available	601	Open in IMG/M
3300010377\|Ga0126328_10364369	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	576	Open in IMG/M
3300010377\|Ga0126328_10369242	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	569	Open in IMG/M
3300010377\|Ga0126328_10370749	Not Available	566	Open in IMG/M
3300010378\|Ga0126330_10026596	Not Available	2923	Open in IMG/M
3300010378\|Ga0126330_10089000	Not Available	1678	Open in IMG/M
3300010378\|Ga0126330_10128668	Not Available	1342	Open in IMG/M
3300010378\|Ga0126330_10146065	Not Available	1236	Open in IMG/M
3300010378\|Ga0126330_10230063	Not Available	877	Open in IMG/M
3300010378\|Ga0126330_10259430	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	791	Open in IMG/M
3300010378\|Ga0126330_10331087	Not Available	634	Open in IMG/M
3300010378\|Ga0126330_10373007	Not Available	568	Open in IMG/M
3300010378\|Ga0126330_10390260	Not Available	545	Open in IMG/M
3300010378\|Ga0126330_10413670	Not Available	517	Open in IMG/M
3300011190\|Ga0126327_10120847	Not Available	1340	Open in IMG/M
3300011190\|Ga0126327_10338136	Not Available	617	Open in IMG/M
3300011190\|Ga0126327_10358893	Not Available	584	Open in IMG/M
3300011190\|Ga0126327_10414892	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	511	Open in IMG/M
3300012273\|Ga0126329_10016420	Not Available	3376	Open in IMG/M
3300012273\|Ga0126329_10027457	Not Available	2806	Open in IMG/M
3300012273\|Ga0126329_10053575	Not Available	2124	Open in IMG/M
3300012273\|Ga0126329_10091249	Not Available	1631	Open in IMG/M
3300012273\|Ga0126329_10127427	Not Available	1346	Open in IMG/M
3300012273\|Ga0126329_10128916	Not Available	1337	Open in IMG/M
3300012273\|Ga0126329_10153172	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1198	Open in IMG/M
3300012273\|Ga0126329_10305193	Not Available	708	Open in IMG/M
3300012273\|Ga0126329_10319210	Not Available	681	Open in IMG/M
3300012273\|Ga0126329_10333627	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	656	Open in IMG/M
3300012273\|Ga0126329_10365383	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	606	Open in IMG/M
3300012273\|Ga0126329_10381754	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	583	Open in IMG/M
3300012273\|Ga0126329_10414019	Not Available	544	Open in IMG/M
3300012273\|Ga0126329_10418401	Not Available	539	Open in IMG/M
3300012273\|Ga0126329_10422547	Not Available	534	Open in IMG/M
3300012273\|Ga0126329_10425301	Not Available	532	Open in IMG/M
3300012273\|Ga0126329_10432657	Not Available	524	Open in IMG/M
3300012273\|Ga0126329_10442088	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	514	Open in IMG/M
3300012273\|Ga0126329_10453334	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	503	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0126333_10071051	3300010290	Marine Gutless Worms	KKGVHQNYEAEVSGRVGGGVSRDVDFGKLFTETNEPKFSLGGVKS
Ga0126333_10194822	3300010290	Marine Gutless Worms	MFIKYEAEVSSRVCGGERGVVDFGKLFTETNEQKFSLGGV*
Ga0126333_10213881	3300010290	Marine Gutless Worms	SEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126333_10422882	3300010290	Marine Gutless Worms	IKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQSTIW*
Ga0126333_10464892	3300010290	Marine Gutless Worms	EAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGV*
Ga0126333_11000591	3300010290	Marine Gutless Worms	EVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126333_11082692	3300010290	Marine Gutless Worms	AEVSSRVSGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126333_11605211	3300010290	Marine Gutless Worms	YEAEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVKS
Ga0126333_11758391	3300010290	Marine Gutless Worms	SEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGEVQS*
Ga0126333_12256111	3300010290	Marine Gutless Worms	KYEAEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVQS
Ga0126333_12754761	3300010290	Marine Gutless Worms	EAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126333_13079352	3300010290	Marine Gutless Worms	AEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126333_13184242	3300010290	Marine Gutless Worms	VFIKYEAEVSSRVNGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126333_13324741	3300010290	Marine Gutless Worms	VFIKYEAEVSSRVSGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126333_13377482	3300010290	Marine Gutless Worms	VFVKYEAEVSSRVGGGERGVVDFGKLFTETNVQKFSLGGVQS*
Ga0126326_10359873	3300010292	Marine Gutless Worms	VFIKYEAEVSSRVSGGERGVVDFGKLFAETNEQKFSLGGVQRKKICSHPG*
Ga0126326_10423172	3300010292	Marine Gutless Worms	VFIKYEAEVSSRVGGGERTVVDFGKLFTETNEQKFSLGGVQS*
Ga0126326_10750943	3300010292	Marine Gutless Worms	EVSSSVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126326_11035371	3300010292	Marine Gutless Worms	VVINEVEVSSRVCGGEREVVDFGKLFTETTEQKFSLGGVQS*
Ga0126326_11869211	3300010292	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQR*
Ga0126326_12253161	3300010292	Marine Gutless Worms	MFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLG
Ga0126326_12645041	3300010292	Marine Gutless Worms	AEVSSRVCGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126326_12709791	3300010292	Marine Gutless Worms	VVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFS
Ga0126326_13228801	3300010292	Marine Gutless Worms	YEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126326_13242952	3300010292	Marine Gutless Worms	VFFKYEAKVSSRLGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126326_13669131	3300010292	Marine Gutless Worms	VFIKYEAEVSSSVGGVERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126332_100104053	3300010294	Marine Gutless Worms	MFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGV*
Ga0126332_100105535	3300010294	Marine Gutless Worms	EVFIKYEAEVSSTVGGGEGVVDFGKLFTETNEQKFSLGGVQS
Ga0126332_101897331	3300010294	Marine Gutless Worms	FIKYEAEVSSRVCGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126332_102732733	3300010294	Marine Gutless Worms	MRSGRKKVVFIKKEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQC*
Ga0126332_102922391	3300010294	Marine Gutless Worms	GKSEVIIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126332_102983171	3300010294	Marine Gutless Worms	AEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQC*
Ga0126332_103410402	3300010294	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVLS*
Ga0126332_103446631	3300010294	Marine Gutless Worms	YEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQIQS*
Ga0126332_103511902	3300010294	Marine Gutless Worms	EAEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVKS
Ga0126334_100551091	3300010295	Marine Gutless Worms	IKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQSSLTP*
Ga0126334_102315002	3300010295	Marine Gutless Worms	FIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGV*
Ga0126334_102545422	3300010295	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVIVLL*
Ga0126334_104054312	3300010295	Marine Gutless Worms	VFIKKEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQC*
Ga0126334_104103202	3300010295	Marine Gutless Worms	VFIKYEAEVSSRVGGGEKGVVNFGKLFTETNEQKFSLGGVQS*
Ga0126334_104180601	3300010295	Marine Gutless Worms	VFIKYEAEVLNSVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_100251484	3300010298	Marine Gutless Worms	FIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQRKKICSHPG*
Ga0126325_100335231	3300010298	Marine Gutless Worms	GKSEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQSYKI*
Ga0126325_100380111	3300010298	Marine Gutless Worms	EAEVSSRVGGCERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_100567461	3300010298	Marine Gutless Worms	EAEVSSSVGGGERGVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_100856052	3300010298	Marine Gutless Worms	EVSSRVSGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_102038092	3300010298	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKE*
Ga0126325_102209261	3300010298	Marine Gutless Worms	VFIKYEAEVSSRVGGGEWGVVNFGKLFTETNEQKFSLGGVKC*
Ga0126325_102253692	3300010298	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKLTT*
Ga0126325_102720282	3300010298	Marine Gutless Worms	VFIKYDAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQC*
Ga0126325_103255862	3300010298	Marine Gutless Worms	AEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVKS
Ga0126325_103472742	3300010298	Marine Gutless Worms	EVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_103991151	3300010298	Marine Gutless Worms	VYIKYEAEVSSRVGDGERGVVDFGKLFTETNEQKFSLGGVQS
Ga0126325_104110041	3300010298	Marine Gutless Worms	VFIKYEAQVSSRVSGGELGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_104349171	3300010298	Marine Gutless Worms	VFIKYEAEVSSRVGGGERKVVDFGKLFTETNEQKFSLGGVQS*
Ga0126325_104494082	3300010298	Marine Gutless Worms	VFIKYEAEVSSRVSGDERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126325_104629092	3300010298	Marine Gutless Worms	MKYEAEVSSTVGGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126331_11818231	3300010314	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGV*
Ga0126331_12921412	3300010314	Marine Gutless Worms	EVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVMCFEQIKI*
Ga0126331_13203401	3300010314	Marine Gutless Worms	AEVSSRVGGGERGVVDFGKLFAETNEQKFSLGGVKS*
Ga0126331_13613321	3300010314	Marine Gutless Worms	VFIKYEAEVSSRVSGGEGVVDFGKLFTETNEQKFSLGGVKS
Ga0126331_13692551	3300010314	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVNFGKLFAETNEQKFNLGGVQS*
Ga0136654_10256693	3300010315	Marine Gutless Worms	EVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVGTHDLTET*
Ga0136654_10813013	3300010315	Marine Gutless Worms	KYEAEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVKS
Ga0136654_10833682	3300010315	Marine Gutless Worms	MKPRFWSRVGGGERGVVDFGKLFTETNEQKFSLGGDWLGRNVS*
Ga0136654_10932971	3300010315	Marine Gutless Worms	VSSRVSGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0136654_11228981	3300010315	Marine Gutless Worms	EVFIKYEAEVSSRVGGGEKGVVDFGKLFTETNEQKFSLGGVKS*
Ga0136654_12520362	3300010315	Marine Gutless Worms	AEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVAQ*
Ga0136654_12671101	3300010315	Marine Gutless Worms	VFIKYEAEVSSRVGCGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0136654_12755421	3300010315	Marine Gutless Worms	IKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0136654_13339592	3300010315	Marine Gutless Worms	FIKYEAEVSSSVGAGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0136654_13670152	3300010315	Marine Gutless Worms	VFIKYEAEVSSSVGGGEKGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126328_100201774	3300010377	Marine Gutless Worms	VFIKYEAKVSSRVSGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126328_100285001	3300010377	Marine Gutless Worms	VSSRVSGGERGVVDFGKLFTETNEQKFSLGGVQC*
Ga0126328_100794001	3300010377	Marine Gutless Worms	GKSEVFIKYEAEVSSRVGGGDRGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126328_101398441	3300010377	Marine Gutless Worms	VRKSEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSL
Ga0126328_101660142	3300010377	Marine Gutless Worms	VFIKYEAEISSRVGGGERGVVDFGKLFTETNEQKFSLGGVQC*
Ga0126328_101923821	3300010377	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVIPPDSC*
Ga0126328_103313361	3300010377	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVRC*
Ga0126328_103391121	3300010377	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLVTETNEQKFSLGGVKS*
Ga0126328_103484011	3300010377	Marine Gutless Worms	IKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKLTT*
Ga0126328_103643692	3300010377	Marine Gutless Worms	VFIKYEAKVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126328_103692422	3300010377	Marine Gutless Worms	VFIKYEAKVLSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126328_103707492	3300010377	Marine Gutless Worms	MFIKYEAEVSSRVCGGEQGVVDFGKLFTETNEQKFSLGGV*
Ga0126330_100265962	3300010378	Marine Gutless Worms	VFIKYDAEVSSRVTGGERGVVDFGKLFTETNEQKFSLGGVK*
Ga0126330_100890002	3300010378	Marine Gutless Worms	SEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGEHTTCV*
Ga0126330_101286681	3300010378	Marine Gutless Worms	SEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGVVEVSLHV*
Ga0126330_101460652	3300010378	Marine Gutless Worms	VTKDEAEVSSRVGGGEREVVDFSKLFTENNEQKFSL*
Ga0126330_102300632	3300010378	Marine Gutless Worms	IKYEAEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVKS
Ga0126330_102594301	3300010378	Marine Gutless Worms	VSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKC*
Ga0126330_103310871	3300010378	Marine Gutless Worms	VFIKYEAEVSSRVGGGKRGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126330_103730071	3300010378	Marine Gutless Worms	VFIKYEAQVSNRVSGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126330_103902601	3300010378	Marine Gutless Worms	VSSSVGGDERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126330_103975462	3300010378	Marine Gutless Worms	IKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGDWLGRNVS*
Ga0126330_104136701	3300010378	Marine Gutless Worms	VFVKYEAEVSSTVGGGERGSVDFGKLFTETNEQKFSLGGVQS*
Ga0126327_101208471	3300011190	Marine Gutless Worms	SEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQT*
Ga0126327_103381361	3300011190	Marine Gutless Worms	IKHEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126327_103588931	3300011190	Marine Gutless Worms	YEAEVSSRVGGGERVVDFGKLFTETNEQKFSLGGVKS*
Ga0126327_104148922	3300011190	Marine Gutless Worms	VFIKYEAEVSSRVGGGDSGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_100164201	3300012273	Marine Gutless Worms	SEVFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGELELEDLQ*
Ga0126329_100274572	3300012273	Marine Gutless Worms	FIKYEAEVSSRVGGGEGVVDFGKLFTETNEQKFSLGGVKSS
Ga0126329_100535751	3300012273	Marine Gutless Worms	AEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVMCFEQIKI*
Ga0126329_100912493	3300012273	Marine Gutless Worms	VSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_101274271	3300012273	Marine Gutless Worms	KYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLEGVQSSA*
Ga0126329_101289161	3300012273	Marine Gutless Worms	AEVSSRVGGGERAVVDFGKLFTETNEQKFSLGGVQSWKICR*
Ga0126329_101531721	3300012273	Marine Gutless Worms	AEVSSRVGGGERGVVDFNKLFTETNEQKFSLGGVKS*
Ga0126329_103051932	3300012273	Marine Gutless Worms	EAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVKS*
Ga0126329_103192101	3300012273	Marine Gutless Worms	EAEVSSRVGGGEVVVDFGKLFTETNEQKFSLGGVKS
Ga0126329_103336272	3300012273	Marine Gutless Worms	VFIKYEAEVSSRSGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_103653831	3300012273	Marine Gutless Worms	VFIKYEAEVSSRVGGGEWGVVNFGKLFTETNEQKFSLGGVKS*
Ga0126329_103817541	3300012273	Marine Gutless Worms	VFNKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_104140191	3300012273	Marine Gutless Worms	AEVSSSVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_104184012	3300012273	Marine Gutless Worms	YEAEVSSRVGGGEREVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_104225471	3300012273	Marine Gutless Worms	EVSSSVGGGERGVVDFGKLFTETNEQKFSLGGVQR*
Ga0126329_104253012	3300012273	Marine Gutless Worms	VFAKYEAEVSSTVGGGERGSVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_104326571	3300012273	Marine Gutless Worms	VFIKYEAEVSSRVSGCERGVVDFGKLFAKTNEEKFSLGGVKSRCN*
Ga0126329_104420882	3300012273	Marine Gutless Worms	VFIKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGVQS*
Ga0126329_104533342	3300012273	Marine Gutless Worms	VFVKYEAEVSSRVGGGERGVVDFGKLFTETNEQKFSLGGV

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F075532

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300010290	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-54 metaG	Host-Associated	Open in IMG/M
3300010292	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-67 metaG	Host-Associated	Open in IMG/M
3300010294	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-42 metaG	Host-Associated	Open in IMG/M
3300010295	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-49 metaG	Host-Associated	Open in IMG/M
3300010298	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG	Host-Associated	Open in IMG/M
3300010314	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG	Host-Associated	Open in IMG/M
3300010315	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-70 metaG	Host-Associated	Open in IMG/M
3300010377	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-13 metaG	Host-Associated	Open in IMG/M
3300010378	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-91 metaG	Host-Associated	Open in IMG/M
3300011190	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-30 metaG	Host-Associated	Open in IMG/M
3300012273	Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign