| Basic Information | |
|---|---|
| Taxon OID | 3300010339 Open in IMG/M |
| Scaffold ID | Ga0074046_10254856 Open in IMG/M |
| Source Dataset Name | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1088 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Calvert Island, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015526 | Metagenome / Metatranscriptome | 254 | Y |
| F100522 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074046_102548562 | F100522 | AGG | MSKNFERWKELAAMCRSEQDPAKLTELANEMNFVLTQKTPHLDPRLLAVGSHEEGQRDPLKANAEGKVCFT* |
| Ga0074046_102548563 | F015526 | GGA | MQLANDPAVGVYTQPLVPYKQLSQTFSVHSTYELKKRVGLNLSVARSFAHRGWRPDLNTADYPNFPGAVTVAGYPSEAAFATAFSNALGIGAGPVSQVNVPQTLVGATGNYDFRSGFDGGLRFNYGSYTDNTIWNTSGVRPNVDGNLQSYSVFFGRVW |
| ⦗Top⦘ |