| Basic Information | |
|---|---|
| Taxon OID | 3300010324 Open in IMG/M |
| Scaffold ID | Ga0129297_10104441 Open in IMG/M |
| Source Dataset Name | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1333 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indonesia: Gulf of Boni | |||||||
| Coordinates | Lat. (o) | -2.75 | Long. (o) | 121.05 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089857 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129297_101044412 | F089857 | N/A | MEKLGIDEKYGKRRQITFHIGPVAQNRLEQAAALFDMKPSEYAKAVLYKDLGVFNEPLDQRRRTWKQRKEKLEELDEEL* |
| ⦗Top⦘ |