NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089857

Metagenome Family F089857

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089857
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 81 residues
Representative Sequence MGSDEKYGKRRQITFRIGPLAQERLKQAAALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Number of Associated Samples 50
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 66.36 %
% of genes near scaffold ends (potentially truncated) 15.74 %
% of genes from short scaffolds (< 2000 bps) 59.26 %
Associated GOLD sequencing projects 46
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (93.519 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(62.963 % of family members)
Environment Ontology (ENVO) Unclassified
(67.593 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(57.407 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.73%    β-sheet: 0.00%    Coil/Unstructured: 53.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF00589Phage_integrase 22.22
PF01555N6_N4_Mtase 1.85
PF03551PadR 1.85
PF13412HTH_24 1.85
PF01402RHH_1 1.85
PF04266ASCH 1.85
PF00493MCM 0.93
PF01637ATPase_2 0.93
PF04014MazE_antitoxin 0.93
PF00361Proton_antipo_M 0.93
PF07690MFS_1 0.93
PF01862PvlArgDC 0.93
PF00753Lactamase_B 0.93
PF01176eIF-1a 0.93
PF14311DUF4379 0.93
PF14511RE_EcoO109I 0.93
PF13659Obsolete Pfam Family 0.93
PF15515MvaI_BcnI 0.93
PF00535Glycos_transf_2 0.93
PF01927Mut7-C 0.93
PF01738DLH 0.93
PF14417MEDS 0.93
PF09171AGOG 0.93
PF07155ECF-ribofla_trS 0.93
PF14520HHH_5 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.85
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 1.85
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 1.85
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 1.85
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.85
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.85
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.85
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 1.85
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.85
COG1672Predicted ATPase, archaeal AAA+ ATPase superfamilyGeneral function prediction only [R] 0.93
COG1656Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domainGeneral function prediction only [R] 0.93
COG1945Pyruvoyl-dependent arginine decarboxylaseAmino acid transport and metabolism [E] 0.93
COG1373Predicted ATPase, AAA+ superfamilyGeneral function prediction only [R] 0.93
COG1241DNA replicative helicase MCM subunit Mcm2, Cdc46/Mcm familyReplication, recombination and repair [L] 0.93
COG4047N-glycosylase/DNA lyase (8-oxoguanine DNA glycosylase)Replication, recombination and repair [L] 0.93
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 0.93
COG4720ECF-type riboflavin transporter, membrane (S) componentCoenzyme transport and metabolism [H] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.52 %
UnclassifiedrootN/A6.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001749|JGI24025J20009_10010878All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5010Open in IMG/M
3300001749|JGI24025J20009_10039871All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota1951Open in IMG/M
3300001782|WOR52_10017412All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon8998Open in IMG/M
3300002966|JGI24721J44947_10025153All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6221Open in IMG/M
3300004212|Ga0066631_10192599All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon937Open in IMG/M
3300005098|Ga0072683_117277Not Available4406Open in IMG/M
3300005099|Ga0072682_107080All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5278Open in IMG/M
3300005236|Ga0066636_10183574All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon957Open in IMG/M
3300008019|Ga0105158_1129576All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon512Open in IMG/M
3300008020|Ga0100398_1229424All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon844Open in IMG/M
3300009503|Ga0123519_10075323All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3161Open in IMG/M
3300010324|Ga0129297_10104441All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1333Open in IMG/M
3300010324|Ga0129297_10273714All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon764Open in IMG/M
3300010328|Ga0129298_10062037All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1779Open in IMG/M
3300010328|Ga0129298_10514476All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon542Open in IMG/M
3300012931|Ga0153915_12883775All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon561Open in IMG/M
(restricted) 3300013127|Ga0172365_10009528All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota7149Open in IMG/M
(restricted) 3300013127|Ga0172365_10013917All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5839Open in IMG/M
(restricted) 3300013127|Ga0172365_10261977All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1039Open in IMG/M
(restricted) 3300013128|Ga0172366_10442138All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon786Open in IMG/M
(restricted) 3300013128|Ga0172366_10633521All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon631Open in IMG/M
(restricted) 3300013130|Ga0172363_10832648All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon573Open in IMG/M
(restricted) 3300013133|Ga0172362_10167821All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1613Open in IMG/M
3300018089|Ga0187774_10228080All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1039Open in IMG/M
3300021493|Ga0190306_1026537All Organisms → cellular organisms → Archaea1027Open in IMG/M
3300021509|Ga0190304_1037920All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1328Open in IMG/M
3300021509|Ga0190304_1123034All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon577Open in IMG/M
3300022551|Ga0212089_10048356All Organisms → cellular organisms → Archaea2498Open in IMG/M
3300022551|Ga0212089_10122571Not Available1360Open in IMG/M
3300022551|Ga0212089_10143082All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1228Open in IMG/M
3300024263|Ga0209978_10224177All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon951Open in IMG/M
3300024423|Ga0190286_1015037Not Available2341Open in IMG/M
3300024423|Ga0190286_1019791All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1990Open in IMG/M
3300025021|Ga0210017_1065073All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1652Open in IMG/M
3300025144|Ga0209725_1200771All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon608Open in IMG/M
3300025314|Ga0209323_10754803All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon519Open in IMG/M
3300025837|Ga0210016_1276272All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon611Open in IMG/M
3300027742|Ga0209121_10041166All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2509Open in IMG/M
3300027742|Ga0209121_10054314Not Available2020Open in IMG/M
3300027742|Ga0209121_10118840All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota1077Open in IMG/M
3300027742|Ga0209121_10246396All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon613Open in IMG/M
3300027863|Ga0207433_10353811All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon956Open in IMG/M
3300027888|Ga0209635_10130343All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2060Open in IMG/M
3300027893|Ga0209636_10006396All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon12034Open in IMG/M
3300027893|Ga0209636_10419021All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1133Open in IMG/M
3300027893|Ga0209636_10626678All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon859Open in IMG/M
3300031586|Ga0315541_1009961All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5672Open in IMG/M
(restricted) 3300031587|Ga0315308_1038814All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2208Open in IMG/M
(restricted) 3300031587|Ga0315308_1068779All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1528Open in IMG/M
(restricted) 3300031604|Ga0315309_1185300All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon815Open in IMG/M
3300031707|Ga0315291_10042559All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5194Open in IMG/M
3300031772|Ga0315288_10015730All Organisms → cellular organisms → Archaea9430Open in IMG/M
3300031772|Ga0315288_10131711All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2809Open in IMG/M
3300031862|Ga0315280_10023437All Organisms → cellular organisms → Archaea6437Open in IMG/M
3300031862|Ga0315280_10025579All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6031Open in IMG/M
3300031862|Ga0315280_10026080All Organisms → cellular organisms → Archaea → TACK group5943Open in IMG/M
3300031862|Ga0315280_10033610All Organisms → cellular organisms → Archaea4884Open in IMG/M
3300031862|Ga0315280_10043166All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4027Open in IMG/M
3300031862|Ga0315280_10044745All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3915Open in IMG/M
3300031862|Ga0315280_10070554All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2732Open in IMG/M
3300031862|Ga0315280_10100946All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2035Open in IMG/M
3300031862|Ga0315280_10112000All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1864Open in IMG/M
3300031862|Ga0315280_10186184All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1211Open in IMG/M
3300031862|Ga0315280_10189533All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1193Open in IMG/M
3300031862|Ga0315280_10445125All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon580Open in IMG/M
3300031862|Ga0315280_10522857All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon510Open in IMG/M
3300031873|Ga0315297_10158396All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1844Open in IMG/M
(restricted) 3300031876|Ga0315310_10382618All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon572Open in IMG/M
3300031885|Ga0315285_10388328All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota1003Open in IMG/M
3300031885|Ga0315285_10799349All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon591Open in IMG/M
3300031885|Ga0315285_10945389All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon522Open in IMG/M
3300031952|Ga0315294_10237219All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1788Open in IMG/M
3300031952|Ga0315294_10264256All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1672Open in IMG/M
3300032020|Ga0315296_10000539All Organisms → cellular organisms → Archaea34636Open in IMG/M
3300032020|Ga0315296_10004148All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota11903Open in IMG/M
3300032020|Ga0315296_10017325All Organisms → cellular organisms → Archaea5269Open in IMG/M
3300032020|Ga0315296_10192071All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1227Open in IMG/M
3300032020|Ga0315296_10276686All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon963Open in IMG/M
3300032020|Ga0315296_10431536All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon711Open in IMG/M
3300032046|Ga0315289_10036467All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6316Open in IMG/M
3300032053|Ga0315284_10107141All Organisms → cellular organisms → Archaea3728Open in IMG/M
3300032069|Ga0315282_10033547All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6332Open in IMG/M
3300032069|Ga0315282_10039653All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5544Open in IMG/M
3300032069|Ga0315282_10062762Not Available3793Open in IMG/M
3300032069|Ga0315282_10068583All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3527Open in IMG/M
3300032069|Ga0315282_10085295All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2943Open in IMG/M
3300032069|Ga0315282_10107869All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2420Open in IMG/M
3300032069|Ga0315282_10141511All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1932Open in IMG/M
3300032069|Ga0315282_10166588All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1692Open in IMG/M
3300032069|Ga0315282_10192349All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1505Open in IMG/M
3300032069|Ga0315282_10500196All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon689Open in IMG/M
3300032070|Ga0315279_10002148All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota30416Open in IMG/M
3300032070|Ga0315279_10242732All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota1356Open in IMG/M
3300032070|Ga0315279_10251565All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1323Open in IMG/M
3300032070|Ga0315279_10529447All Organisms → cellular organisms → Archaea763Open in IMG/M
3300032070|Ga0315279_10587745All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon704Open in IMG/M
3300032070|Ga0315279_10805555All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon551Open in IMG/M
3300032118|Ga0315277_10064808All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Methanodesulfokores → Candidatus Methanodesulfokores washburnensis4200Open in IMG/M
3300032118|Ga0315277_10778844All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon907Open in IMG/M
3300032118|Ga0315277_11363808All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon617Open in IMG/M
3300032163|Ga0315281_10000008All Organisms → cellular organisms → Archaea324952Open in IMG/M
3300032163|Ga0315281_10276379Not Available1843Open in IMG/M
3300032163|Ga0315281_10775764All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon991Open in IMG/M
3300032163|Ga0315281_11892127All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon573Open in IMG/M
3300032401|Ga0315275_10347399All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1662Open in IMG/M
3300033991|Ga0334965_0000453All Organisms → cellular organisms → Archaea32568Open in IMG/M
3300033991|Ga0334965_0002713All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon12031Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment62.96%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment7.41%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine5.56%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater3.70%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment3.70%
Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment2.78%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring2.78%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.85%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat1.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.93%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer0.93%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.93%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.93%
Marine SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment0.93%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001749Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3EnvironmentalOpen in IMG/M
3300001782Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samplesEnvironmentalOpen in IMG/M
3300002966Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01EnvironmentalOpen in IMG/M
3300004212Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00EnvironmentalOpen in IMG/M
3300005098Hydrothermal sediment microbial communities from the Guaymas Basin, Gulf of California, Pacific Ocean - 8, 4-6cmbsfEnvironmentalOpen in IMG/M
3300005099Hydrothermal sediment microbial communities from the Guaymas Basin, Gulf of California, Pacific Ocean - 10, 8-11cmbsfEnvironmentalOpen in IMG/M
3300005236Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80EnvironmentalOpen in IMG/M
3300008019Hot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_matchedEnvironmentalOpen in IMG/M
3300008020Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22EnvironmentalOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300010324Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaGEnvironmentalOpen in IMG/M
3300010328Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300021493Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-3-4_MGEnvironmentalOpen in IMG/M
3300021509Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-1--2_MGEnvironmentalOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300024263Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024423Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MGEnvironmentalOpen in IMG/M
3300025021Groundwater microbial communities from aquifer - Crystal Geyser CG08_land_8/20/14_0.20 (SPAdes)EnvironmentalOpen in IMG/M
3300025144Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025837Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 (SPAdes)EnvironmentalOpen in IMG/M
3300027742Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027893Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)EnvironmentalOpen in IMG/M
3300031586Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-190EnvironmentalOpen in IMG/M
3300031587 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3EnvironmentalOpen in IMG/M
3300031604 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031876 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033991Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bactEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI24025J20009_1001087813300001749MarineMSPPEKYGKRRQITFRIGPIAQDRLERAAELFQMKPGQYVKAVLYQQLGIFNEPLDRRRRSYKQKKSQQQLEEEESTEEF*
JGI24025J20009_1003987143300001749MarineMSPPEKYGKRRQITFRIGPIAQDRLERAAELFDMKPGKYVKAVLYQQLGIFNEPLDRRRRSWKRKKSQQQREEEELLCEDSE*
WOR52_1001741273300001782Marine SedimentMSVFNKRGKRRQITFRIGPIAQERLERAADLFDMKPSQYAKAVLYRDLGVFNEPLDRRRRTWKRKERLEQLEEEEDFHID*
JGI24721J44947_1002515383300002966Hot SpringMEKLGIDEKYGKRRQITFRIGPVCQDRLERAAALFNMKPSEYAKAVLYKDLGIFDEPLDQRRRTWRQKKQRLDEDDF*
Ga0066631_1019259923300004212GroundwaterLSPDEKYGKRRQITFRIGPIVQDRLERAAALFNMKPCEYAKALLYKDLGVFDEPLDQRRRAWKQKKRRLEDEEFVEEGL*
Ga0072683_11727733300005098MarineMSPSEKYGKRRQITFRIGPIAQERLKQAAALFNMKPSQYAKAVIYKDLGVFNEPLDMRRKTWKKRKMQLEKEEF*
Ga0072682_10708023300005099MarineMNKYGKRRQITFRIGPIAEDRLRQVAALFNMRPTEYVKALLYKDLGVFNEPLDRRRRSWKKKRLQLNQEEP*
Ga0066636_1018357423300005236GroundwaterLSPDEKYGKRRQITFRIGPIVQDRLERAAALFNMKPCEYAKALLYKDLGVFDEPLDQRRRVWKQKKRRLEDEEFVEEGL*
Ga0105158_112957613300008019Hot SpringMSPPDKYGKRRQITFRIGPIAEDRLRQMAALFNMKPAEYAKAVLYKDLNVFNEPLDQRRRSWRKKTTQGIRRIRGTGNRQSP*
Ga0100398_122942423300008020AquiferMEKLSVGEKHGKRRQITFRIGPICEDRLRRAAALFNMKPTDYAKAIIYKDLGVFEEPLDQRRRSWKQHERKQQFEEEE
Ga0123519_1007532343300009503Hot SpringMEKMSPPDKYGKRRQITFRIGPLAEDRLRQVAALFNMKPAEYAKAVLYRDLAIFNEPLDQRRRSWRKKKLEDENLELRPCRGSIY*
Ga0129297_1010444123300010324Lake SedimentMEKLGIDEKYGKRRQITFHIGPVAQNRLEQAAALFDMKPSEYAKAVLYKDLGVFNEPLDQRRRTWKQRKEKLEELDEEL*
Ga0129297_1027371413300010324Lake SedimentHGSMENLSPREKYGKRIQITFRITAVAMDRLERAAALFRMTPGEYAKAILYRDLAVFDEPLDMRRRSWKRKKRLEQQLEEEQLEIEKHSLGSE*
Ga0129298_1006203713300010328Lake SedimentMLKDCKTWGIIKLRADEKYGKRRQITFRIGPLAQERLKQASALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKQQSEDEEFGEEG*
Ga0129298_1051447613300010328Lake SedimentMAKHGGMEKLGIDEKYGKRRQITFRIGPVAQNRLEQAAALFDMKPSEYAKAVLYKDLGVFNEPLDQRRRTWKQRKEKLEELDEEL*
Ga0153915_1288377523300012931Freshwater WetlandsRIGPLAQERLKQTSALFNMKPCEYVKAVLYRDLTIFDEPLDQRRRAWKQKKRQLQENECGEEGS*
(restricted) Ga0172365_1000952883300013127SedimentVKIQCSTTAKHGGIEKLGIDEKYGKRRQITFRIGPVAQDRLKRAAALFNMKPTEYAKAILYKDLGIFDEPLDQRRRIWKQKQQFSEDDF*
(restricted) Ga0172365_1001391733300013127SedimentVKIQCSTTAKHGGIKKLGIDEKYGKRRQITFRIGPVAQDRLKRAAALFNMKSSEYAKAVLYKDLGIFDEPLDQRRRTWKQKKKRLLSEDDF*
(restricted) Ga0172365_1026197733300013127SedimentEKYGKRIQITFRITPVAMDRLERASALFRMTPGEYTKAVLYRDLGVWEEPLDQRRRSWKQHKKKQQFEEDEDQPLEIERHGNL*
(restricted) Ga0172366_1044213823300013128SedimentMEKLGIDEKYGKRIQITFRITPVAMDRLERASALFRMTPGEYTKAVLYRDLGVWEEPLDQRRRAWKQHKKKQQFEEDEDQ
(restricted) Ga0172366_1063352113300013128SedimentMEKLGYHEKYGKRRQITFRIGPIAQDRLAQAAALFNMKPSEYAKAILYKDLGVFDEPLDQRRRTWKQRKEKLKEFDEEL*
(restricted) Ga0172363_1083264813300013130SedimentMEKLGYAEKYGKRIQITFRITPVAMDRLERASALFRMTPGEYTKAVLYRDLGVWEEPLDQRRRAWKHKKKQQLIEEEEDQQLEIEKHGNL*
(restricted) Ga0172362_1016782143300013133SedimentLGYAEKYGKRIQITFRITPVAMDRLERASALFRMTPGEYTKAVLYRDLGVWEEPLDQRRRAWKHKKKQQLIEEEEDQQLEIEKHGNL*
Ga0187774_1022808013300018089Tropical PeatlandVKIQCSTIAKHGGIEKLGIDEKYGKRRQITFRIGPIVQDRLERAAALFNMKPSEYAKAVLYKDLGIFDEPLDQRRRTWRQKKHQISEDDF
Ga0190306_102653723300021493Hydrothermal Vent SedimentMSPSEKYGKRRQITFRIGPIAQERLKQAAALFNMKPSQYAKAVIYKDLGVFNEPLDMRRKTWKKRKMQLEKEEF
Ga0190304_103792043300021509Hydrothermal Vent SedimentMNKYGKRRQITFRIGPIAEDRLRQVAALFNMKPTEYVKALLYKDLQVFNEPLDRRRRSWKKKKQQPEEAFRGTTNPEDLPGI
Ga0190304_112303413300021509Hydrothermal Vent SedimentMSPSEKYGKRRQITFRIGPIAQERLKQAAALFNMKPSQYAKAVIYKDLGVFNEPLDMRRKTWKKRKMQLE
Ga0212089_1004835613300022551Lake SedimentMLKDCKTWGIIKLRADEKYGKRRQITFRIGPLAQERLKQASALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKQQSEDEEFGEEG
Ga0212089_1012257133300022551Lake SedimentLSPREKYGKRIQITFRITAVAMDRLERAAALFRMTPGEYAKAILYRDLAVFDEPLDMRRRSWKRKKRLEQQLEEEQLEIEKHSLGSE
Ga0212089_1014308223300022551Lake SedimentMAKHGGMEKLGIDEKYGKRRQITFRIGPVAQNRLEQAAALFDMKPSEYAKAVLYKDLGVFNEPLDQRRRTWKQRKEKLEELDEEL
Ga0209978_1022417723300024263Deep SubsurfaceMEKMSTDEKYGKRRQITFRVDEIAWDRLKQAANLFNMKPSQYAKALLYKDLGLFNIPLDRRTRNWKRIVRRELEE
Ga0190286_101503753300024423Hydrothermal Vent Microbial MatMNKYGKRRQITFRIGPIAEDRLKQVAALFNMRPTEYVKALLYKDLGIFNEPLDMRRRTWKQKKRLQLKEELEPGRATRKGPRPPRNLSWVGNG
Ga0190286_101979133300024423Hydrothermal Vent Microbial MatMNKYGKRRQITFRIGPIAEDRLRQVAALFNMRPTEYVKALLYKDLGVFNEPLDRRRRSWKKKRLQLEEELEPGRATRKGPRNF
Ga0210017_106507323300025021GroundwaterLSPDEKYGKRRQITFRIGPIVQDRLERAAALFNMKPCEYAKALLYKDLGVFDEPLDQRRRAWKQKKRRLEDEEFVEEGL
Ga0209725_120077113300025144Lake SedimentREKYGKRIQITFRITAVAMDRLERAAALFRMTPGEYAKAILYRDLAVFDEPLDMRRRSWKRKKRLEQQLEEEQLEIEKHSLGSE
Ga0209323_1075480313300025314SoilLSPDEKYGKRRQITFRIGPVCQDRLARAAALFNLKPSEYAKAVLYKDLGIFEEPLDQRRRIWKQQKKAKQLDEEEDETF
Ga0210016_127627223300025837GroundwaterLSVGEKHGKRRQITFRIGPICEDRLRRAAALFNMKPTDYAKAIIYKDLGVFEEPLDQRRRSWKQ
Ga0209121_1004116633300027742MarineMSPPEKYGKRKQITFRIGPLMQDRLEQAAALFDMKPTEYVKALLYQHLGILNEPLDRRKRSYKRKKRRQQQAEEEEQMLCEDSE
Ga0209121_1005431423300027742MarineMSPPEKYGKRRQITFRIGPIAQDRLERAAELFDMKPGQYAKAILYQQLGIFNEPLDRRKRSYKRKKKQQQAEEQEWCEDE
Ga0209121_1011884023300027742MarineMSPPEKYGKRRQITFRIGPIAQDRLERAAELFDMKPGKYVKAVLYQQLGIFNEPLDRRRRSWKRKKSQQQREEEELLCEDSE
Ga0209121_1024639623300027742MarineMSPPEKYGKRRQITFRIGPIAQDRLERAAELFDMKPGQYAKALLYKDLGVFNEPLDRRKHSWRQKKQQQQAEEEELLCEDSGQ
Ga0207433_1035381143300027863Hot SpringMEKMSPPDKYGKRRQITFRIGPIAEDRLRQMAALFDMKPAEYAKAVLYRDLGVFNEPLDQRRRSWRKKKQQMEDEAFRGDTNNHLKGLKP
Ga0209635_1013034323300027888Marine SedimentMSPPEKYGKRRQITFRIGPIAQERLERAAELFDMKPSQYAKAVLYRDLSVFNEPLDRRRRTWKRKERLQLEEEEDF
Ga0209636_1000639683300027893Marine SedimentMSVFNKRGKRRQITFRIGPIAQERLERAADLFDMKPSQYAKAVLYRDLGVFNEPLDRRRRTWKRKERLEQLEEEEDFHID
Ga0209636_1041902123300027893Marine SedimentMSPPEKYGKRRQITFRIGPVAQERLERAAELFDMKPSQYAKAVLYRDLGVFNEPLDRRRRTWKRKERLEQLEEESF
Ga0209636_1062667813300027893Marine SedimentMSPPEKYGKRRQITFRIGPIVQERLERAAELFDMKPSQYAKAVLYRDLGVFNEPLDRRRRMWKRKEKLQLEEEEDF
Ga0315541_100996123300031586Salt Marsh SedimentMSPPEKYGKRRQITFRIGPIAQDRLERAAELFDMKPSQYAKAVLYRDLGVFNEPLDRRRRTWKRKERLQQQEEEEFDLE
(restricted) Ga0315308_103881423300031587SedimentLGIDEKYGKRRQITFRIGPVAQDRLRRAAALFNMKPSEYAKAILYRDLGIFDEPLDQRRRTWRQKKAKDQGLDEEDF
(restricted) Ga0315308_106877933300031587SedimentMEKLSLHEKYGKRRQITFRIGPIAQDRLDQAAVLFNMKPTEYAKAIIYKDLGVFDELLDQRRRSWRQHKRKKQQHEDEEQLEIEKRKDF
(restricted) Ga0315309_118530023300031604SedimentLGTDEKYGKRRQITFRIGPVAQDRLERAATLFNMKPTEYAKAVLYKDLGIFDEPLDRRRRTWRQKKQQFDEDDF
Ga0315291_1004255923300031707SedimentMGSDEKYGKRRQITFRVGPLAQERLKQASALFNMKPCEYVKAVLYRDLAIFDESLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315288_1001573053300031772SedimentMSPDEKYGKRRQITFRIGPLAQERLKQTSALFNMKPCEYVKAVLYRDLTIFDEPLDQRRRAWKQKKRQFQENEFGEEGS
Ga0315288_1013171133300031772SedimentMGSDEKYGKRRQITFRVGPLAQERLKQASGLFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315280_1002343723300031862SedimentMENLSVGEKYGKRHQITFRIGPIAQDRLERPAALFRMTPGEYTKAVLYRDLGIFDEPLDQRHRSWKQHKRKQQLEEEQLEIEKHEDF
Ga0315280_1002557973300031862SedimentLGIDEKYGKRRQITFRIGPVAQDRLERAAALFNLKPSEYAKAILYKDLGIFDEPLDQRRRTWKQKKKQLLSEDDF
Ga0315280_1002608053300031862SedimentMGPDEKYGKRRQITFRIGPLAQERLKQTAALFNMKPCEYAKAILYRDLAIFDEPLDQRRHAWKQKKRQSENEPIDKGELQENE
Ga0315280_1003361073300031862SedimentLGIDEKYGKRRQITFRIGPLAQDRLKRAAALFNMKPTEYAKAILYKDLGIFDEPLDQRRRTWRQKKQQFSEDDF
Ga0315280_1004316623300031862SedimentLGIDEKYGKRRQITFRIGPIAQERLKQAAALFNLKPSEYAKAVLYRDLGIFDEPLDQRRRTWKQKKAQLLSEDDF
Ga0315280_1004474523300031862SedimentMQKLGIDEKYGKRRQITFRIGPVAQDRLKRAASLFNMKPTEYAKAVLYRDLGIFDEPLDRRRRSWRQKKQRFDEDDF
Ga0315280_1007055433300031862SedimentMPKPAKTQAFRRIVKMQYQKIAKHGGIEKLGIDEKYGKRRQITFRIGPVAQERLKQAAALFNLKPSEYAKAILYRDLGIFDEPLDQRRRTWKQKKAQLLSEDDF
Ga0315280_1010094623300031862SedimentMPKPAKTQAFRRIVKMQYQKIAKHGGIEKLGIDEKYGKRRQITFRIGPVAQDRLKRAASLFNMKPTEYAKAILYKDLGIFDEPLDQRRRSWRQKKKQFDEDDF
Ga0315280_1011200053300031862SedimentLSMDEKYGKRRQITFRIGPIAEDKLRQVAALFNMKPSEYAKAVLYRDLGVFNESLDQRRRSWKQQKRRHQEDEEYG
Ga0315280_1018618423300031862SedimentMEKLSIDEKYGKRRQITFRIGPIAQDRLQQASALFNMKPSEYAKAILYRDLGVFNESLDQRRRAWKQRKEKLQQLDEEL
Ga0315280_1018953333300031862SedimentMENLTGAEKYGKRRQITFRIGTIVQDRLERAAALFNMKPCEYAKALLYKDLGVFDEPLDKRRRGWKAKKRQREDEEFGEGV
Ga0315280_1044512513300031862SedimentMAKPAKTQAFRRIVKMQYQKIAKHGGIEKLGIDEKYGKRRQITFRIGPIAQERLKQAAALFNLKPSEYAKAILYRDLGIFDEPLD
Ga0315280_1052285713300031862SedimentMGSDEKYGKRRQITFRIGPLAQERLKQAAALFNMKPCEYVKAILYKDLAVFDEPLDQRRHAWRQKKQQSEDEELGELGREQKF
Ga0315297_1015839623300031873SedimentMGSDEKYGKRRQITFRVGPLAQERLKQASGLFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGMLGHG
(restricted) Ga0315310_1038261823300031876SedimentMENLSPREKYGKRIQITFRITAVAMDRLERAAALFRMTPGEYAKAILYRELAVFDEPLDMRRRSYKRKKRLEQQLEEEQLEIEKHSLGSE
Ga0315285_1038832823300031885SedimentMGPEEKYGKRHQITFRIGPLAQERLKQAAALFNMKPCEYVKAILYRDFTIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315285_1079934923300031885SedimentVGSDEKYGKRRQITFRIGPLAQERLKQASALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGMLGHG
Ga0315285_1094538913300031885SedimentKHGGIMKLGADEKYGKRRQITFRVGPLALDRLKQASALFNMKPCEYVKAVLYRDLAVFDEPLDQRRRAWKQRKRRLQDEEFGEEG
Ga0315294_1023721933300031952SedimentLRADEKYGKRRQITFRVGPLAQERLKQAAALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315294_1026425613300031952SedimentEKYGKRRQITFRIGPLAQERLKQAAALFNMKPCEYVKAILYRDLTIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315296_1000053933300032020SedimentMGPDEKYGKRRQITFRIGPLAQERLKQASGLFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315296_10004148113300032020SedimentMGSDEKYGKRRQITFRIGPLAQERLKQASALFNMKPCEYVKAVLYRDMAIFDEPLDQRRRAWKQKKLQLQDEEFGEEGMLGHG
Ga0315296_1001732583300032020SedimentLGIDEKYGKRRQITFRIGPVAQDRLERAAALFNMKPSEYAKAVLYKDLGIFDEPLDQRRRTWKQQKRKQQFEDEDQF
Ga0315296_1019207113300032020SedimentLSVGEKYGKRHQITFRIGPIAQDRLERPAALFRMTPGEYTKAVLYRDLGIFDEPLDQRHRSWKQHKRKQQLEEEQLEIEKHEDF
Ga0315296_1027668613300032020SedimentMSPDEKYGKRRQITFRIGPLAQERLRQAAALFNMKPCEYVKAILYRDLAIFDEPLDQRRRAWKQKKREPQDEEFGEEGL
Ga0315296_1043153623300032020SedimentMQYQKIAKHGGIEKLGIDEKYGKRRQITFRIGPVCQDRLKRAAALFNMKPSEYAKAVLYRDLGIFDEPLDQRRRTWKQKKKQLLSEDDF
Ga0315289_1003646793300032046SedimentLRADEKYGKRRQITFRVGPLAQERLKQAAALFNMKPCEYVKAVLYKDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315284_1010714163300032053SedimentMGSDEKYGKRRQITFRIGPLAQERLKQASGLFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGMLGHG
Ga0315284_1067971733300032053SedimentMEKLSLDEKYGKRRQVTFRIGPIAEDKLAQMAKLFHMKPPQYVKAILYKDLGVFCESLDQRRRDQKRRK
Ga0315282_1003354723300032069SedimentMQKLSIDEKYGKRRQITFRIGPVAQDRLKRAASLFNMKPTEYAKAVLYRDLGIFDEPLDQRRRTWRQKKQQFSEDDF
Ga0315282_1003965383300032069SedimentLGIDEKYGKRRQITFRIGLVAQDRLERAAALFNMKPTEYAKAILYKDLGIFDEPLDQRRRSWRQKKQRFDENDF
Ga0315282_1006276293300032069SedimentLGIDEKYGKRRQITFRIGPVAQDRLKRAASLFNMKPTEYAKAILYKDLGIFDEPLDQRRRSWRQKKKQFDEDDF
Ga0315282_1006858333300032069SedimentMAVHGGMEKLSMDEKYGKRRQITFRIGPIAEDKLRQVAALFNMKPSEYAKAVLYRDLGVFNESLDQRRRYWKQQKRRHQEDEEYC
Ga0315282_1008529523300032069SedimentLSLSEMDGKRRQITFRIGPIAQDRLEHAAALFNMKPTEYAKAVLYKDLGVFNEPLDQRRRTWKQKKKRELENDDKLFSEELE
Ga0315282_1010786933300032069SedimentLGIDEKYGKRRQITFRIGPLAQERLKQAAALFNLKPSEYAKAILYKDLGIFDEPLDQRRRTWKQKKKQLLSEDDF
Ga0315282_1014151123300032069SedimentLGIDEKYGKRRQITFRIGPLAQERLKQAAALFNLKPSEYAKAILYRDLGIFDEPLDQRRRTWKQKKAQLLSEDDF
Ga0315282_1016658823300032069SedimentLGINEKYGKRRQITFRIGPVAQDRLKRAAALFNMKPTEYAKAILYKDLGIFDEPLDQRRRTWRQKKQQLDEDDF
Ga0315282_1019234923300032069SedimentLTGAEKYGKRRQITFRIGTIVQDRLERAAALFNMKPCEYAKALLYKDLGVFDEPLDRRRRGWKAKKRQREDEEFGEGV
Ga0315282_1050019613300032069SedimentMQKLSIDEKYGKRRQITFRIGPVAQDRLKRAAALFNMKPSEYAKAVLYRDLGIFDEPLDQRRRSWRQKKKQFDEDDF
Ga0315279_1000214853300032070SedimentMRQDEKYGKRRQVSFRIGPVAEDRLARAAALFNMKGCEYVKAVLYKDLGIYDEPPDRRRLAWLKQKRRMQQEEEDDSSLLCETNP
Ga0315279_1024273223300032070SedimentMGPEEKYGKRRQITFRIGPLAQERLKQAAALFNMKPCEYVKAILYRDFTIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315279_1025156513300032070SedimentGKRRQITFRIGPLAQERLKQAAVLFNMKPCEYVKAVLYRDLAIFDEPLDQRRHAWKQKERQSESEPHDEGEL
Ga0315279_1052944733300032070SedimentMGSDEKYGKRRQITFRIGPLAQERLKQAAALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGL
Ga0315279_1058774523300032070SedimentLGSDEKYGKRRQITFRIGCVCEDRLGRVSALFNLKPTEYAKSLLYKDLGIFDEPLDKRRHAWKQKERQSGNEPTDKGEL
Ga0315279_1080555523300032070SedimentLRADEKYGKRRQITFRIGPLAQERLKQASGLFSMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEE
Ga0315277_1006480843300032118SedimentMGPDEKYGKRRQITFRIGPLAQERLKQAAVLFNMKPCEYVKAVLYRDLAIFDEPLDQRRHAWKQKERQSESEPHDEGEL
Ga0315277_1077884413300032118SedimentLRQDEKHGKRRQVSFRIGPVCEDRLARAAALFNMKPCEYVKAVLYKDLGIYDEPPDRRRLAWLKQKRQLQREDEDASLFCETSPNKGLGV
Ga0315277_1136380813300032118SedimentMGSDEKYGKRRQITFRIGVVCEDRLERVAVLFNLKPTEYAKALLYKDLGVFDEPLDKRRHTWKQKERQSESEPIDKGELQENE
Ga0315281_10000008713300032163SedimentMGPDEKYGKRRQITFRIGPLCQERLARAAALFNLKSCEYVKAILYRDLAIFDEPLDQRRSAWKKQQRQRLEDERGQDEGEL
Ga0315281_1027637913300032163SedimentLRADEKYGKRRQITFRIGPLAQERLKQASGLFNIKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGMLGHG
Ga0315281_1077576433300032163SedimentMAVHGGMEKLSMDEKYGKRRQITFRIGPIAEDKLRQVAALFNMKPSEYAKAVLYRDLGVFNESLDQRRRSWKQQKRRHQEDEEYG
Ga0315281_1189212723300032163SedimentEKYGKRRQITFRIGPIVQDRLERAAALFNMKPCEYAKALLYKDLGVFDEPLDKRRRGWKEKKRRREDEEFREGL
Ga0315275_1034739923300032401SedimentMGSDEKYGKRRQITFRVGPLAQERLKQASALFNMKPCEYVKAVLYRDLAIFDEPLDQRRRAWKQKKRQLQDEEFGEEGMLGHG
Ga0334965_0000453_18228_185363300033991SedimentVAKHGGYGKTRPEEKYGKRRQITFRIGPIVQDRLVRTAALFNLKPCEYVKALLYKDLQVFDEPLDQRRRAWLQQKRRQLEDDSYEDLLEQDRSIAAEVKKRK
Ga0334965_0002713_8682_89183300033991SedimentMEKLGIDEKYGKRRQITFRIGPVAQDRLKRAAALFNMKPTEYAKAILYKDLGIFDEPLDQRRRTWRQKKQQSEDEDDF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.