Basic Information | |
---|---|
Taxon OID | 3300010313 Open in IMG/M |
Scaffold ID | Ga0116211_1164200 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 574 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Africa: Limpopo | |||||||
Coordinates | Lat. (o) | -22.5304 | Long. (o) | 30.6814 | Alt. (m) | Depth (m) | 1.5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072632 | Metagenome / Metatranscriptome | 121 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116211_11642001 | F072632 | N/A | LDIKSKDNSEDCQNTVTQLRRVVNDVNTFTNGEECIQFIEDINDNKVCMIISGSLGQHVVPRVHNMSQVDSIFIFCGNPKYHEWSKKWPKIKGVFTSIAPICEALKQASQQCEQNAISISVVATSGNEANTNLDRLDPMFMYSQIIKEILLTIDFELKHFKININR* |
⦗Top⦘ |