| Basic Information | |
|---|---|
| Taxon OID | 3300010285 Open in IMG/M |
| Scaffold ID | Ga0134091_1099620 Open in IMG/M |
| Source Dataset Name | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 2_5_20_6_A2 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 507 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Thermotalea → Thermotalea metallivorans | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Dartmouth College, New Hampshire | |||||||
| Coordinates | Lat. (o) | 43.726 | Long. (o) | -72.1429 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001938 | Metagenome / Metatranscriptome | 614 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0134091_10996203 | F001938 | N/A | MIEKIYKNKRMAICDNCGEGQECDSWAEVIDFMREEGWRKRLIDGEWKHFCPECRGVKEP |
| ⦗Top⦘ |