| Basic Information | |
|---|---|
| Taxon OID | 3300010280 Open in IMG/M |
| Scaffold ID | Ga0129308_1016728 Open in IMG/M |
| Source Dataset Name | Ring-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2107 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Ring-Tailed Lemur Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076064 | Metagenome | 118 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129308_10167283 | F076064 | N/A | LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPKPALKFY* |
| ⦗Top⦘ |