| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010280 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120398 | Gp0147144 | Ga0129308 |
| Sample Name | Ring-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenome |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 294047809 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CAG:74_58_120 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Ring-Tailed Lemur Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061388 | Metagenome | 132 | N |
| F076064 | Metagenome | 118 | N |
| F099451 | Metagenome | 103 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0129308_1014432 | All Organisms → Viruses → Predicted Viral | 2419 | Open in IMG/M |
| Ga0129308_1016728 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis | 2107 | Open in IMG/M |
| Ga0129308_1045579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CAG:74_58_120 | 910 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0129308_1014432 | Ga0129308_10144323 | F099451 | VNNGCAPENTLRGFKLAKIMRIDKIKTVGQLRKVIENLSDDYEIEMRIRRKLTDEDIIKLHKKYGKIYPYPYETSYSELEFDDVGVSDKVLCLGVELKE* |
| Ga0129308_1016728 | Ga0129308_10167283 | F076064 | LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPKPALKFY* |
| Ga0129308_1045579 | Ga0129308_10455793 | F061388 | YATQFRATALPRNERGAYYSPRDDSVHLSIHSVAQGDSISTPYSVLFHEYGHMTDYLIARGEGRSRYSAYSDLFQGIGADGKPILRRSSSGGLLGRTAKDELEGHLSRIRSRNPSMTRDQAARRLVSEAMGKYSVRDRSDISDMFEGAGIGIPYPLGSGHGLDYWSARGNGKEIFAEIVSAEAAHPGSLKAIKEYFPKTYQVYQDMVKARKKK* |
| ⦗Top⦘ |