Scaffold Ga0129308_1014432

Overview

Basic Information

• Taxon OID: 3300010280
• Scaffold ID: Ga0129308_1014432
• Source Dataset Name: Ring-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2419
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Ring-Tailed Lemur Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.07
  • Long. (^o): -89.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099451	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129308_10144323	F099451	AGG	VNNGCAPENTLRGFKLAKIMRIDKIKTVGQLRKVIENLSDDYEIEMRIRRKLTDEDIIKLHKKYGKIYPYPYETSYSELEFDDVGVSDKVLCLGVELKE*