Scaffold Ga0129311_1029075

Overview

Basic Information

• Taxon OID: 3300010278
• Scaffold ID: Ga0129311_1029075
• Source Dataset Name: Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022B metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1445
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Western Lowland Gorilla Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.78
  • Long. (^o): -88.79

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129311_10290753	F029444	N/A	MEVSEQLTGFELEDLMSWTVSNLQRPFREDFSLEKSGIIAEKESQIFGRRFVGFDRPKKRRPFSISKSVICSP*