Basic Information | |
---|---|
Taxon OID | 3300010277 Open in IMG/M |
Scaffold ID | Ga0134093_1079788 Open in IMG/M |
Source Dataset Name | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 4_13_20_68_A1 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 567 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Dartmouth College, New Hampshire | |||||||
Coordinates | Lat. (o) | 43.726 | Long. (o) | -72.1429 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F101010 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134093_10797882 | F101010 | GGAGG | MILFNNVYATVWEIEDKGNFVKGRISTSEKNKEGKYVNSYWFATFVGKAKEPALALSAKDRIKITSGKISNTITGEGKDKKSFVNVVIFDFENLSNSQIDSQMDDLPF* |
⦗Top⦘ |