| Basic Information | |
|---|---|
| Taxon OID | 3300010275 Open in IMG/M |
| Scaffold ID | Ga0129310_1011659 Open in IMG/M |
| Source Dataset Name | Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022A metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3394 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Western Lowland Gorilla Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.78 | Long. (o) | -88.79 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129310_10116591 | F026592 | N/A | SPQGIAALAVQGGVATLTERSDATFAGKQFSSADRE* |
| ⦗Top⦘ |