Scaffold Ga0129310_1001196

Overview

Basic Information

• Taxon OID: 3300010275
• Scaffold ID: Ga0129310_1001196
• Source Dataset Name: Western lowland gorrila individual fecal microbial communities from Wisconsin, USA - Go1022A metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 24042
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (85.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → unclassified Collinsella → Collinsella sp. 4_8_47FAA (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Western Lowland Gorilla Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.78
  • Long. (^o): -88.79

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099269	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129310_10011969	F099269	GAG	VGELLLLDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCASV*