Scaffold Ga0134096_1033477

Overview

Basic Information

• Taxon OID: 3300010273
• Scaffold ID: Ga0134096_1033477
• Source Dataset Name: Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 7_21_20_110_A3 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1011
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location

• Location Name: USA: Dartmouth College, New Hampshire
• Coordinates
  • Lat. (^o): 43.726
  • Long. (^o): -72.1429

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010244	Metagenome / Metatranscriptome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134096_10334771	F010244	GGAGG	MTHKVKFTHSNKSRARINRAKVREGKEVYRHPRGYFVVLEFEGESGKFREAFWPE