Scaffold Ga0134095_1013637

Overview

Basic Information

• Taxon OID: 3300010271
• Scaffold ID: Ga0134095_1013637
• Source Dataset Name: Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 6_20_20_110_A2 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2229
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location

• Location Name: USA: Dartmouth College, New Hampshire
• Coordinates
  • Lat. (^o): 43.726
  • Long. (^o): -72.1429

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001938	Metagenome / Metatranscriptome	614	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134095_10136375	F001938	N/A	VIEMIEKIYKNKYMATCDNCGTGQECDSWADVMEFMREEGWKKKLVDGEWKHYCPECQEVKEP*