Scaffold Ga0129306_1009673

Overview

Basic Information

• Taxon OID: 3300010270
• Scaffold ID: Ga0129306_1009673
• Source Dataset Name: Capybara group fecal microbial communities from Wisconsin, USA - P827 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3947
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → Prevotella copri (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Capybara Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.07
  • Long. (^o): -89.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041506	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129306_10096736	F041506	N/A	MNKVYTLEDNDGLLAELKSMRGKMAEMRGRLERDEITPDEWRQWHAGYRARLDEIKEAISGMRDEISLRNADLERQKHERAAELNMTFEEYENYLKSLIIS*