Basic Information | |
---|---|
Taxon OID | 3300010270 Open in IMG/M |
Scaffold ID | Ga0129306_1004287 Open in IMG/M |
Source Dataset Name | Capybara group fecal microbial communities from Wisconsin, USA - P827 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9450 |
Total Scaffold Genes | 14 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (78.57%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Capybara Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084966 | Metagenome | 111 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129306_10042872 | F084966 | AGGAG | MLMLSLDDAAKVAKRLVADGVDDDEIIRQELEQKCWIPPESSKAAKDLNDLIFDINPAEICSQIEADNLRQWCDILQAEMKMAMVQLPCWANGDDNE* |
⦗Top⦘ |