Scaffold Ga0134097_1007204

Overview

Basic Information

• Taxon OID: 3300010268
• Scaffold ID: Ga0134097_1007204
• Source Dataset Name: Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 8_30_10_142_A2 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4451
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (58.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location

• Location Name: USA: Dartmouth College, New Hampshire
• Coordinates
  • Lat. (^o): 43.726
  • Long. (^o): -72.1429

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019116	Metagenome / Metatranscriptome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134097_10072048	F019116	GAGG	MKKKTSIMLSARDKRLLELLAKKEARSQTKELEYLIRRRADELEIKIEEP*