Scaffold Ga0129314_1042156

Overview

Basic Information

• Taxon OID: 3300010266
• Scaffold ID: Ga0129314_1042156
• Source Dataset Name: Orangutan individual fecal microbial communities from fecal samples from Wisconsin, USA - O1111 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 914
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Orangutan Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.78
  • Long. (^o): -88.79

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099269	Metagenome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129314_10421561	F099269	N/A	KEASAAMRRPPFCARCTFECASGELLLLDDLGDRASGASVLASATGDAGVLVSDGSDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCASV*