| Basic Information | |
|---|---|
| Taxon OID | 3300010266 Open in IMG/M |
| Scaffold ID | Ga0129314_1009819 Open in IMG/M |
| Source Dataset Name | Orangutan individual fecal microbial communities from fecal samples from Wisconsin, USA - O1111 metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3031 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Orangutan Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wisconsin | |||||||
| Coordinates | Lat. (o) | 43.78 | Long. (o) | -88.79 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0129314_10098192 | F032286 | N/A | MVKWVCQIVTPVRHRALVFNTRLFAGNAADDTLVTGGTFRFCRLMCLCVKRRNVKPDSKHRSLPDSALFHADNRTERKTISPFSLALIFTFDFAALSERRSCPEDRSRRFVLLGALDAALRRRAYPVRTVMQFSRFRCDCKTILAKNIALSRISKRS* |
| ⦗Top⦘ |