NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129314_1001437

Scaffold Ga0129314_1001437


Overview

Basic Information
Taxon OID3300010266 Open in IMG/M
Scaffold IDGa0129314_1001437 Open in IMG/M
Source Dataset NameOrangutan individual fecal microbial communities from fecal samples from Wisconsin, USA - O1111 metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16513
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Orangutan Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.78Long. (o)-88.79Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036964Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0129314_10014375F036964AGGAGGMNVLKILFPALMVVGALGSLIVNIVGKGNHATSLQWLGACLLYTALMLRNRG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.