Basic Information | |
---|---|
Taxon OID | 3300010266 Open in IMG/M |
Scaffold ID | Ga0129314_1001437 Open in IMG/M |
Source Dataset Name | Orangutan individual fecal microbial communities from fecal samples from Wisconsin, USA - O1111 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 16513 |
Total Scaffold Genes | 26 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (80.77%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Orangutan Individual Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.78 | Long. (o) | -88.79 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036964 | Metagenome / Metatranscriptome | 169 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129314_10014375 | F036964 | AGGAGG | MNVLKILFPALMVVGALGSLIVNIVGKGNHATSLQWLGACLLYTALMLRNRG* |
⦗Top⦘ |