Scaffold Ga0129315_1004126

Overview

Basic Information

• Taxon OID: 3300010260
• Scaffold ID: Ga0129315_1004126
• Source Dataset Name: Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm827 metagenome
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3835
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.07
  • Long. (^o): -89.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068855	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129315_10041266	F068855	N/A	VPTVEAQGPQVRKSLAPQGLQAEKESENANVRNAGWLHSFDADYHYRGSDLHYHVNVSAALSEEGAAW*