Basic Information | |
---|---|
Taxon OID | 3300010260 Open in IMG/M |
Scaffold ID | Ga0129315_1004126 Open in IMG/M |
Source Dataset Name | Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm827 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3835 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068855 | Metagenome | 124 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129315_10041266 | F068855 | N/A | VPTVEAQGPQVRKSLAPQGLQAEKESENANVRNAGWLHSFDADYHYRGSDLHYHVNVSAALSEEGAAW* |
⦗Top⦘ |