Scaffold Ga0136508_10449

Overview

Basic Information

• Taxon OID: 3300010244
• Scaffold ID: Ga0136508_10449
• Source Dataset Name: Processed tobacco microbial communities from Atlanta, GA, USA - retail point 1 - domestic moist snuff M6 re-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Centers for Disease Control and Prevention (CDC), USA
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 11159
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (18.75%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Tobacco → Processed Tobacco Microbial Communities From Domestic Moist Snuff Usa

Source Dataset Sampling Location

• Location Name: Atlanta
• Coordinates
  • Lat. (^o): 33.881
  • Long. (^o): -84.294

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045048	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136508_104491	F045048	N/A	VTPDDNNKTVFNKGNSKGFTACIPNGGHCAPNSTLGDIALWKNAQKIAKKKNASETMNKPTPRFNPFCTAFV*