3300010244: Processed tobacco microbial communities from Atlanta, GA, USA - retail point 1 - domestic moist snuff M6 re-assembly

Overview

Basic Information

• IMG/M Taxon OID: 3300010244
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0111475 | Gp0104062 | Ga0136508
• Sample Name: Processed tobacco microbial communities from Atlanta, GA, USA - retail point 1 - domestic moist snuff M6 re-assembly
• Sequencing Status: Permanent Draft
• Sequencing Center: Centers for Disease Control and Prevention (CDC), USA
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 29071363
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Processed Tobacco Microbial Communities From Domestic Moist Snuff Usa
• Type: Engineered
• Taxonomy: Engineered → Food Production → Unclassified → Unclassified → Unclassified → Processed Tobacco → Processed Tobacco Microbial Communities From Domestic Moist Snuff Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant corpus

Location Information

• Location: Atlanta
• Coordinates
  • Lat. (^o): 33.881
  • Long. (^o): -84.294
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045048	Metagenome / Metatranscriptome	153	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0136508_10449	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	11159

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136508_10449	Ga0136508_104491	F045048	VTPDDNNKTVFNKGNSKGFTACIPNGGHCAPNSTLGDIALWKNAQKIAKKKNASETMNKPTPRFNPFCTAFV*