Scaffold Ga0136485_1016901

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136485_1016901

Scaffold Ga0136485_1016901

Overview

Basic Information
Taxon OID	3300010243 Open in IMG/M
Scaffold ID	Ga0136485_1016901 Open in IMG/M
Source Dataset Name	Marine sediment microbial community from clay-turbidite interface sediment within the South China Sea
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	548
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea

Source Dataset Sampling Location
Location Name	South China Sea
Coordinates	Lat. (^o)	12.91889	Long. (^o)	115.04722	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102405	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136485_10169012	F102405	N/A	SAAFLLLYKRKEGSIMAQEVNLLDPLGIVKAVRGQVNQMAISAKLPPLPEMPTIKMSMAGLPLLNKFNQIPDRPGMSRGERAG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.