| Basic Information | |
|---|---|
| Taxon OID | 3300010243 Open in IMG/M |
| Scaffold ID | Ga0136485_1009591 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community from clay-turbidite interface sediment within the South China Sea |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 638 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South China Sea | |||||||
| Coordinates | Lat. (o) | 12.91889 | Long. (o) | 115.04722 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014684 | Metagenome / Metatranscriptome | 261 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136485_10095912 | F014684 | GGAG | MTWHQYYFRIIGFALAGAGAGLILDELIHGPFTLTPANHEFWGLVALVAGCVLISKKPHGKILS* |
| ⦗Top⦘ |