Basic Information | |
---|---|
Taxon OID | 3300010242 Open in IMG/M |
Scaffold ID | Ga0136484_1005045 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community from turbidite sediment within the South China Sea |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 571 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South China Sea | |||||||
Coordinates | Lat. (o) | 12.91889 | Long. (o) | 115.04722 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074370 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136484_10050452 | F074370 | AGGGGG | MADELAKKLAEAKKKMLGAQQPSGKIIILVKGDSLIKSADPKVEVRQLE* |
⦗Top⦘ |