| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300010242 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0121458 | Gp0154500 | Ga0136484 |
| Sample Name | Marine sediment microbial community from turbidite sediment within the South China Sea |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Oregon State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 47748427 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 1 |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine benthic biome → marine benthic feature → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | South China Sea | |||||||
| Coordinates | Lat. (o) | 12.91889 | Long. (o) | 115.04722 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020845 | Metagenome | 221 | Y |
| F074370 | Metagenome / Metatranscriptome | 119 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0136484_1000080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | 2259 | Open in IMG/M |
| Ga0136484_1005045 | Not Available | 571 | Open in IMG/M |
| Ga0136484_1005873 | Not Available | 550 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0136484_1000080 | Ga0136484_10000803 | F020845 | VQTTKNKQEEVGRISISETQELVLSIVDQEKLDIRIWIKTDSYDGPTKRGVRFYLFDDNWPEFKKLMEKMDKVYEV* |
| Ga0136484_1005045 | Ga0136484_10050452 | F074370 | MADELAKKLAEAKKKMLGAQQPSGKIIILVKGDSLIKSADPKVEVRQLE* |
| Ga0136484_1005873 | Ga0136484_10058732 | F074370 | MADKMAEKLAEAKKKMFGAQQPSGKIIILVKGDSLIQCKDPKVEVRQLE* |
| ⦗Top⦘ |