NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010242

3300010242: Marine sediment microbial community from turbidite sediment within the South China Sea



Overview

Basic Information
IMG/M Taxon OID3300010242 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0121458 | Gp0154500 | Ga0136484
Sample NameMarine sediment microbial community from turbidite sediment within the South China Sea
Sequencing StatusPermanent Draft
Sequencing CenterOregon State University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size47748427
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Interfaces Within Marine Sediments From The South China Sea
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine benthic biomemarine benthic featuremarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationSouth China Sea
CoordinatesLat. (o)12.91889Long. (o)115.04722Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020845Metagenome221Y
F074370Metagenome / Metatranscriptome119Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136484_1000080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium2259Open in IMG/M
Ga0136484_1005045Not Available571Open in IMG/M
Ga0136484_1005873Not Available550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136484_1000080Ga0136484_10000803F020845VQTTKNKQEEVGRISISETQELVLSIVDQEKLDIRIWIKTDSYDGPTKRGVRFYLFDDNWPEFKKLMEKMDKVYEV*
Ga0136484_1005045Ga0136484_10050452F074370MADELAKKLAEAKKKMLGAQQPSGKIIILVKGDSLIKSADPKVEVRQLE*
Ga0136484_1005873Ga0136484_10058732F074370MADKMAEKLAEAKKKMFGAQQPSGKIIILVKGDSLIQCKDPKVEVRQLE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.