Scaffold Ga0136484_1000080

Overview

Basic Information

• Taxon OID: 3300010242
• Scaffold ID: Ga0136484_1000080
• Source Dataset Name: Marine sediment microbial community from turbidite sediment within the South China Sea
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2259
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea

Source Dataset Sampling Location

• Location Name: South China Sea
• Coordinates
  • Lat. (^o): 12.91889
  • Long. (^o): 115.04722

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020845	Metagenome	221	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136484_10000803	F020845	GGAGG	VQTTKNKQEEVGRISISETQELVLSIVDQEKLDIRIWIKTDSYDGPTKRGVRFYLFDDNWPEFKKLMEKMDKVYEV*