Basic Information | |
---|---|
Taxon OID | 3300010242 Open in IMG/M |
Scaffold ID | Ga0136484_1000080 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community from turbidite sediment within the South China Sea |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2259 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → unclassified Clostridia → Clostridia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Microbial Communities From Interfaces Within Marine Sediments From The South China Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South China Sea | |||||||
Coordinates | Lat. (o) | 12.91889 | Long. (o) | 115.04722 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020845 | Metagenome | 221 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136484_10000803 | F020845 | GGAGG | VQTTKNKQEEVGRISISETQELVLSIVDQEKLDIRIWIKTDSYDGPTKRGVRFYLFDDNWPEFKKLMEKMDKVYEV* |
⦗Top⦘ |