| Basic Information | |
|---|---|
| Taxon OID | 3300010235 Open in IMG/M |
| Scaffold ID | Ga0136247_10025814 Open in IMG/M |
| Source Dataset Name | Terrestrial oil reservoir microbial community from Schrader Bluff Formation, Alaska - SB2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Yale Center for Genome Analysis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1081 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alaska, USA | |||||||
| Coordinates | Lat. (o) | 70.4 | Long. (o) | -148.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F022442 | Metagenome / Metatranscriptome | 214 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136247_100258142 | F022442 | AGGAGG | MTFIPAGEARLDLYTDAMLLDIGPDTFVVPLDRLADLTAHRRREVVVSRRYWGDAPGTFRDVEQGLRLRRSQTGRSLMLIEQGRVYSIPVYLVLEVKDGIRESCTISMLVTDARQLDDAHSRQTVLEVWA* |
| ⦗Top⦘ |