Basic Information | |
---|---|
Taxon OID | 3300010235 Open in IMG/M |
Scaffold ID | Ga0136247_10007733 Open in IMG/M |
Source Dataset Name | Terrestrial oil reservoir microbial community from Schrader Bluff Formation, Alaska - SB2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Yale Center for Genome Analysis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2586 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.Bin155 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alaska, USA | |||||||
Coordinates | Lat. (o) | 70.4 | Long. (o) | -148.7 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082738 | Metagenome / Metatranscriptome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136247_100077334 | F082738 | AGGA | MKTNAKGRRCAPTVTARRLEQFPGKGTAYIRDGTPNPRLTRPEDYGWTEISDAEIAKFARLGYDLWYKTASTGGAHRVYRSLKKAGQK* |
⦗Top⦘ |