Basic Information | |
---|---|
Taxon OID | 3300010232 Open in IMG/M |
Scaffold ID | Ga0136447_1010436 Open in IMG/M |
Source Dataset Name | Halite microbial communities from Salar Grande, Atacama Desert, Chile, 2016. Combined Assembly of Gp0154194 and Gp0154467 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Johns Hopkins Bayview Research CORES |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7589 |
Total Scaffold Genes | 19 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (73.68%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Haloferacaceae → Haloplanus → unclassified Haloplanus → Haloplanus sp. GDY1 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Evaporite → Halite Endoliths Microbial Communities Diversity Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Salar Grande, Atacama desert, Chile | |||||||
Coordinates | Lat. (o) | -21.0011111 | Long. (o) | -70.07138889 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003128 | Metagenome | 506 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136447_10104366 | F003128 | N/A | MQIEIQPSDIKSGKKADERGRITLGADYAEQTVTVAVLDVDEEDE* |
⦗Top⦘ |