Basic Information | |
---|---|
Taxon OID | 3300010231 Open in IMG/M |
Scaffold ID | Ga0136216_1046755 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Fidelity Systems Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 703 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bangor area, North Wales, UK | |||||||
Coordinates | Lat. (o) | 53.24 | Long. (o) | -4.01 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098280 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136216_10467552 | F098280 | N/A | PNTLKPVVEQVARDFYQNFNSIKGDTINQSEETIEFASRIAPADAISTSITKYLQPYSYTWEATMFKTENYEEAVEKYKIYYRQLNGSKLTYYDKTSYNLSGRYDAXXXRYDAPDEARAFASSILQLNPSNNNLQFFKVEIGLSYSLPEWTVKVMIYEKIADDKIRPTIEVPIR* |
⦗Top⦘ |