NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136216_1046755

Scaffold Ga0136216_1046755


Overview

Basic Information
Taxon OID3300010231 Open in IMG/M
Scaffold IDGa0136216_1046755 Open in IMG/M
Source Dataset NameSoil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week5, replicate 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterFidelity Systems Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)703
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location
Location NameBangor area, North Wales, UK
CoordinatesLat. (o)53.24Long. (o)-4.01Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F098280Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0136216_10467552F098280N/APNTLKPVVEQVARDFYQNFNSIKGDTINQSEETIEFASRIAPADAISTSITKYLQPYSYTWEATMFKTENYEEAVEKYKIYYRQLNGSKLTYYDKTSYNLSGRYDAXXXRYDAPDEARAFASSILQLNPSNNNLQFFKVEIGLSYSLPEWTVKVMIYEKIADDKIRPTIEVPIR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.