| Basic Information | |
|---|---|
| Taxon OID | 3300010227 Open in IMG/M |
| Scaffold ID | Ga0136219_1005874 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Fidelity Systems Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1283 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bangor area, North Wales, UK | |||||||
| Coordinates | Lat. (o) | 53.24 | Long. (o) | -4.01 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F097870 | Metagenome / Metatranscriptome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136219_10058743 | F097870 | N/A | LRQLSEQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEEENIPTA* |
| ⦗Top⦘ |