| Basic Information | |
|---|---|
| Family ID | F097870 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 42 residues |
| Representative Sequence | EEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 96.15 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.154 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.846 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.231 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.70% β-sheet: 0.00% Coil/Unstructured: 80.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF00117 | GATase | 63.46 |
| PF00581 | Rhodanese | 2.88 |
| PF13551 | HTH_29 | 1.92 |
| PF04525 | LOR | 1.92 |
| PF13561 | adh_short_C2 | 1.92 |
| PF01565 | FAD_binding_4 | 1.92 |
| PF00561 | Abhydrolase_1 | 1.92 |
| PF13480 | Acetyltransf_6 | 0.96 |
| PF12697 | Abhydrolase_6 | 0.96 |
| PF01904 | DUF72 | 0.96 |
| PF02371 | Transposase_20 | 0.96 |
| PF13185 | GAF_2 | 0.96 |
| PF01957 | NfeD | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 1.92 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.96 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.15 % |
| All Organisms | root | All Organisms | 28.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.85% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.85% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.88% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001532 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010227 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2 | Engineered | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_08841880 | 2124908009 | Soil | AYAFFNNNNQTNGVAQAPAGALLLRKLLEEEKVPVA |
| E41_03313160 | 2170459005 | Grass Soil | YAFFNNNNQTHGVAQAPAGALLLRKLLEDENIPTA |
| JGI10216J12902_1005292392 | 3300000956 | Soil | AYAFFNNNNQTNGVAQAPDGAFLLRKLLEEEKVPVA* |
| JGI10216J12902_1173199062 | 3300000956 | Soil | EAYAFFNNNNQTHGVPQATAGADLLRKLLEEEGVPTA* |
| A20PFW1_10324411 | 3300001532 | Permafrost | EEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEDVPTA* |
| A15PFW1_103373822 | 3300001534 | Permafrost | EEAYAFFNNNNQTNGVAQAPAGAQLLRKLLKEENVPTA* |
| A3PFW1_106616202 | 3300001535 | Permafrost | EEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEAEKIPTA* |
| C688J18823_101555831 | 3300001686 | Soil | AFFNNNNQTNGVAQAAAGTQLLRKLLEEEGVPTA* |
| C688J35102_1190102511 | 3300002568 | Soil | LREWVEPLRELAGRSEEAYAFFNNNNQTGGVAQAPAGAELLRKLLQEREVEVA* |
| Ga0062589_1008017142 | 3300004156 | Soil | WVPALRELSSEADEAYAFFNNNNQTNGVAQAPAGAMLLRKLLEEEDVPVA* |
| Ga0066674_104116481 | 3300005166 | Soil | ELSEQAEEAYAFFTNNNQTNGVAQAPDGAMLLRKLLEEEGVPTA* |
| Ga0070660_1011420132 | 3300005339 | Corn Rhizosphere | AAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEEENVPTA* |
| Ga0070711_1012869602 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SAEESYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEKIPTA* |
| Ga0070708_1011699331 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA* |
| Ga0070739_104778461 | 3300005532 | Surface Soil | YAFFNNNNQTNGVAQAPSGAELLRKLLEEHDVAVA* |
| Ga0070731_101684042 | 3300005538 | Surface Soil | EAYAFFNNNNQTNGVAQAPAGAELLRRLLEEESVPVG* |
| Ga0070731_109097201 | 3300005538 | Surface Soil | AYAFFNNNNQTGGVAQAPAGAELLRRLLEEESVPVG* |
| Ga0066700_102311401 | 3300005559 | Soil | AYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEHVPTA* |
| Ga0066670_105663492 | 3300005560 | Soil | YAFFNNNNQTNGVAQAPAGAMLLKKLLEEEGVPTA* |
| Ga0066706_108416852 | 3300005598 | Soil | AYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEHVPTG* |
| Ga0070762_106650671 | 3300005602 | Soil | AENAYAFFNNNNQTDGVAQAPAGAALLRKLLDEESVPTA* |
| Ga0070740_104179931 | 3300005607 | Surface Soil | YAFFNNNNQTNGVAQAPAGADLLRRLLEEENVPTA* |
| Ga0068856_1004410303 | 3300005614 | Corn Rhizosphere | QAAEAYAFFNNNNQTHGVAQAPAGALLLRRLLEEEDIPTA* |
| Ga0068856_1022137511 | 3300005614 | Corn Rhizosphere | QAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLQEESIPTA* |
| Ga0066903_1016960803 | 3300005764 | Tropical Forest Soil | AEQAYAFFNNNNQTNGVAQAPAGAELLRRLLEEHEVPTA* |
| Ga0066903_1058596062 | 3300005764 | Tropical Forest Soil | AEQAYAFFNNNNQTNGVAQAPAGAELLRKLLEEHDVPNS* |
| Ga0066903_1074724572 | 3300005764 | Tropical Forest Soil | YAFFNNNNQTNGVAQAPAGAELLRRLLEEQGVPNA* |
| Ga0066903_1084447741 | 3300005764 | Tropical Forest Soil | AYAFFNNNNQTNGVAQAPAGAQLLRRLLEEGDVPVA* |
| Ga0070717_112482312 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EEAYAFFNNNNQTNGVAQAPAGAQLLRKLLDEEHVANA* |
| Ga0070716_1015941382 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SEEAYAFFNNNNQTHGVAQAPAGAQLLRKLLEQEGVPTA* |
| Ga0075425_1027893642 | 3300006854 | Populus Rhizosphere | YAFFNNNNQTHGVAQAPAGAELLRKLLEEHDVPVV* |
| Ga0068865_1009318861 | 3300006881 | Miscanthus Rhizosphere | YAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA* |
| Ga0079219_107062282 | 3300006954 | Agricultural Soil | SAAAQEAYAFFNNNNQTDGVAQAPAGAQLLRKLLEEEDVPTA* |
| Ga0066710_1005959955 | 3300009012 | Grasslands Soil | YAFFNNNNQTNGVAQAPAGAQLLRRLLEENDVPTG |
| Ga0066710_1041019523 | 3300009012 | Grasslands Soil | LSGRAEKAYAFFNNNNQTNGVAQAPAGAFLLRKLLEEEGVPTA |
| Ga0105245_121528142 | 3300009098 | Miscanthus Rhizosphere | CEWTPPLRELSNQSEEAYAFFNNNNQTDGVAQAAAGAQLLRKLLEEEEVPTA* |
| Ga0066709_1044681981 | 3300009137 | Grasslands Soil | RELASASEEAYAFFNNNNQTNGVAQAPAGAYLLRKLLEEESVPTA* |
| Ga0114129_114508071 | 3300009147 | Populus Rhizosphere | EAYAFFNNNNQTNGVAQTPARAFLLRKLLEEEGVPTS* |
| Ga0136219_10058743 | 3300010227 | Soil | LRQLSEQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEEENIPTA* |
| Ga0134084_104626262 | 3300010322 | Grasslands Soil | REWVPPLRELSNQAEQAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEHVPTA* |
| Ga0126383_119535932 | 3300010398 | Tropical Forest Soil | YAFFNNNNQTNGVAQAPAGAILLRKLLEEEKVPVA* |
| Ga0134123_109286071 | 3300010403 | Terrestrial Soil | EAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA* |
| Ga0137776_16590821 | 3300010937 | Sediment | QAYAFFNNNNQTNGVAQAPAGALLLRKLLEEDGVPTA* |
| Ga0150985_1159256172 | 3300012212 | Avena Fatua Rhizosphere | HAFFNNNNQTDGVAQAAAGAQLLRKLLEEEKVPTA* |
| Ga0137375_102392365 | 3300012360 | Vadose Zone Soil | AYAFFNNNNQTAGVAQAPAGAELLRKLLEQENVPVG* |
| Ga0137390_113889011 | 3300012363 | Vadose Zone Soil | AFFNNNNQTNGVAQAPAGALLLRKLLEEEKIPTA* |
| Ga0157349_10476212 | 3300012489 | Unplanted Soil | AFFNNNNVSNGVAQAPDGAFLLRKLLEREGVPVA* |
| Ga0137395_104957042 | 3300012917 | Vadose Zone Soil | RQLAGEAEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPVG* |
| Ga0164298_116942752 | 3300012955 | Soil | PLRELSAQAEEAYAFFNNNNQTNGVAQAPAGAFLLRKLLEEEGVPVA* |
| Ga0164302_106375251 | 3300012961 | Soil | GPLRELSNQAEEAYAFFNNNNQTNGGAQAPARAQLLRKLLEAATVPTA* |
| Ga0164309_116260162 | 3300012984 | Soil | WVDPLRELAGKSDEAYAFFNNNNQTNGVAQAPAGAQLLAKLLEEENVPLA* |
| Ga0164307_112567531 | 3300012987 | Soil | ESYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEKIPTA* |
| Ga0164306_113682852 | 3300012988 | Soil | IGPLRELSGASEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA* |
| Ga0157370_117925052 | 3300013104 | Corn Rhizosphere | GPLRELSNESEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA* |
| Ga0157369_101350395 | 3300013105 | Corn Rhizosphere | PLRQLSEQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEDDDIPTA* |
| Ga0157369_114801142 | 3300013105 | Corn Rhizosphere | EDELREWVAPLRDSSNQAEETFAFFNNNNQTDGVAQAPAGAQLLRKLLDDDGVPTA* |
| Ga0157378_100559274 | 3300013297 | Miscanthus Rhizosphere | VPPLRELSNRSEEAYAFFNNNNQTHGVAQAPAGAQLLRKLLEQEGVPTA* |
| Ga0157372_107290051 | 3300013307 | Corn Rhizosphere | AFFNNNNQTDGVAQAPAGAQLLRKLLDDDGVPTA* |
| Ga0120173_10247511 | 3300014031 | Permafrost | LRELSNQSEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA* |
| Ga0120149_10210044 | 3300014058 | Permafrost | SHQAEETYAFFNNNNQTNGVAQAPAGAFLLRRLLDEEHVPAA* |
| Ga0182008_103727342 | 3300014497 | Rhizosphere | AEAYAFFNNNNQTHGVAQAPAGALLLRKLLEEENIPTA* |
| Ga0182006_12669931 | 3300015261 | Rhizosphere | PSLRQLSEQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEDENIPTA* |
| Ga0184605_104178492 | 3300018027 | Groundwater Sediment | ELREWVPTLRELSGQSEEAYAFFNNNNQTNGVAQAPAGAFLLRKLLEEEGVPTA |
| Ga0187766_114367802 | 3300018058 | Tropical Peatland | YAFFNNNNQTDGVAQAPAGALLLRKLLEEEGVPAT |
| Ga0187765_107812622 | 3300018060 | Tropical Peatland | AGEAEQVYAFFNNNNQTDGVAQAPAGALLLRKLLEEEGVPAT |
| Ga0197907_101576982 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | STEAEEAYVFFNNNNETNGVAQAPAGALLLRKLLDEEQVATA |
| Ga0206354_101417066 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | FAFFNNNNQTDGVAQAPAGAQLLRKLLDDDGVPTA |
| Ga0193699_102505612 | 3300021363 | Soil | ELSNQSEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLDEENVPTA |
| Ga0213881_105339551 | 3300021374 | Exposed Rock | RSLAEQAEQAYAFFNNNNQTNGVAQAAAGALLLRKLLEEEHVPTA |
| Ga0207663_111027902 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ANSAEESYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEKIPTA |
| Ga0207687_112940661 | 3300025927 | Miscanthus Rhizosphere | PLRELSNQSEEAYAFFNNNNQTDGVAQAAAGAQLLRKLLEEEEVPTA |
| Ga0207687_112953432 | 3300025927 | Miscanthus Rhizosphere | RELSNRSEEAYAFFNNNNQTHGVAQAPAGAQLLRKLLEQEGVPTA |
| Ga0207700_107014903 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AEEAYAFFNNNNQTDGVAQAPAGATLLRKLLDDEGVPTA |
| Ga0207669_106022481 | 3300025937 | Miscanthus Rhizosphere | EEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA |
| Ga0207677_110927951 | 3300026023 | Miscanthus Rhizosphere | QSEEAYAFFNNNNQTDGVAQAAAGAQLLRKLLEEEEVPTA |
| Ga0207702_118308101 | 3300026078 | Corn Rhizosphere | RKLAGEAEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLDEEGVPVA |
| Ga0207683_103994524 | 3300026121 | Miscanthus Rhizosphere | NRSEEAYAFFNNNNQTHGVAQAPAGAQLLRKLLEQEGVPTA |
| Ga0207683_111876541 | 3300026121 | Miscanthus Rhizosphere | RELASASEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEENVPTA |
| Ga0209059_13359851 | 3300026527 | Soil | LRELSNRSEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEESVPTA |
| Ga0209811_102006681 | 3300027821 | Surface Soil | EWVAPLRELAGSAQQAYAFFNNNNQTHGVAQAPAGAELLRKLLEEHDVPVA |
| Ga0265319_12729862 | 3300028563 | Rhizosphere | AEQTFAFFNNNNQTDGVAQAPAGAELLRSLLDDHDVPAA |
| Ga0307317_102275952 | 3300028720 | Soil | LSNQSEQAYAFFNNNNQTDGVAQAAAGAQLLRKLLEEEEVPTA |
| Ga0307310_104787651 | 3300028824 | Soil | REWVPPLRELSTQAEQAYAFFNNNNQTHGVAQAPAGALLLRKLLEEEDVPVA |
| Ga0265325_101752583 | 3300031241 | Rhizosphere | LREWETPLRELSNQAEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEKIPTA |
| Ga0265340_103663752 | 3300031247 | Rhizosphere | ELAGAAEHAYAFFNNNNQSDGVAQAPAGAALLRKLLDEESVPTA |
| Ga0318515_101317601 | 3300031572 | Soil | RRLGEEAEEAYAFFNNNNQTDGVAQAPAGARLLRKLLEEDGVPTA |
| Ga0306917_105330612 | 3300031719 | Soil | PLRELSGQAEQAYAFFNNNNQTNGVAQAPAGAQLLRKLLEQEGVPAG |
| Ga0318493_103449661 | 3300031723 | Soil | AYVFFNNNNQTNGVAQAPAGAELLRKLLEEADVPTA |
| Ga0318547_106135391 | 3300031781 | Soil | SEEAEEAYALFNNNNQTNGVAQAPAGAFLLRKLLDEEGITAA |
| Ga0318552_102519082 | 3300031782 | Soil | AYAFFNNNNQTNGVAQAPAGAELLRRLLEDQGVPNA |
| Ga0306919_107309581 | 3300031879 | Soil | VQPLRELSGQAEQAYAFFNNNNQTNGVAQAPAGALLLRKLLEEEGVPAG |
| Ga0318522_101959542 | 3300031894 | Soil | LAAGAEQAYAFFNNNNQTNGVAQAPAGAELLRKLLADQGVPNA |
| Ga0308175_1008892931 | 3300031938 | Soil | REWVPSLRQLSEQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEAESIPTA |
| Ga0308175_1014489731 | 3300031938 | Soil | RELSNQSEEAYAFFNNNNQTNGVAQAPAGAALLRKLLDEQNVPTA |
| Ga0318553_106734691 | 3300032068 | Soil | PLRELSSGAEQAYAFFNNNNQTNGVAQAPAGAELLRKLLEEADVPTA |
| Ga0308173_120874122 | 3300032074 | Soil | EQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEEENIPTA |
| Ga0307472_1006085583 | 3300032205 | Hardwood Forest Soil | NQAEEAYAFFNNNNQTNGVAQAPAGAQLLRKLLEEEHVPAA |
| Ga0335079_1001695011 | 3300032783 | Soil | PLRELSGASEQTYAFFNNNNQTDGVAQAPAGAELLRELLEEQNVPVG |
| Ga0335077_110806613 | 3300033158 | Soil | EAYAFFNNNNQTNGVAQAPAGALLLRKLLEEEDVPVA |
| Ga0318519_110168851 | 3300033290 | Soil | YAFFNNNNQTDGAAQAPAGAFLLRKLLEEENVPTA |
| Ga0310810_106197641 | 3300033412 | Soil | QLRRLSEQAAEAYAFFNNNNQTHGVAQAPAGALLLRKLLEAESIPTA |
| Ga0326731_11626022 | 3300033502 | Peat Soil | AEWVEPLRELTAGAEQAYAFFNNNNQTNGVAQAPAGAELLRRLLEEHDVPVA |
| Ga0247830_112266141 | 3300033551 | Soil | EWVEPLRELAGQSEEAYAFFNNNNQTNGAAQAPAGAQLLAKLLEKEDVPLA |
| Ga0370484_0208300_1_147 | 3300034125 | Untreated Peat Soil | EPLRELAGAAEQTYAFFNNNNQTDGVAQAPAGAELLRKLLEDGNVPVA |
| ⦗Top⦘ |