Scaffold Ga0136160_1080002

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136160_1080002

Scaffold Ga0136160_1080002

Overview

Basic Information
Taxon OID	3300010225 Open in IMG/M
Scaffold ID	Ga0136160_1080002 Open in IMG/M
Source Dataset Name	Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DNAVision
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1857
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1

Source Dataset Sampling Location
Location Name	Shanxi Taiyuan, China
Coordinates	Lat. (^o)	37.87	Long. (^o)	112.54	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136160_10800021	F029983	AGGTGG	MSLCDTVGNKWVTVMDGVKFEFNDIISFYKKNESERKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.