NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010225

3300010225: Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1



Overview

Basic Information
IMG/M Taxon OID3300010225 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121398 | Gp0154056 | Ga0136160
Sample NameSitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1
Sequencing StatusPermanent Draft
Sequencing CenterDNAVision
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size343704580
Sequencing Scaffolds142
Novel Protein Genes143
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available51
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae9
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora49
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha5
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum6
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Phylloxeroidea → Phylloxeridae → Daktulosphaira → Daktulosphaira vitifoliae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis1
All Organisms → cellular organisms → Eukaryota → Opisthokonta3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Schizaphis → Schizaphis graminum1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Rhopalosiphum → Rhopalosiphum maidis1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Diuraphis → Diuraphis noxia1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Chaitophorinae → Sipha → Sipha flava1
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1
TypeHost-Associated
TaxonomyHost-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationShanxi Taiyuan, China
CoordinatesLat. (o)37.87Long. (o)112.54Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136160_1002693Not Available1217Open in IMG/M
Ga0136160_1002736All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae5782Open in IMG/M
Ga0136160_1003169All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2243Open in IMG/M
Ga0136160_1003925All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae3485Open in IMG/M
Ga0136160_1004925Not Available2108Open in IMG/M
Ga0136160_1005155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae25847Open in IMG/M
Ga0136160_1005570All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora6259Open in IMG/M
Ga0136160_1006194Not Available732Open in IMG/M
Ga0136160_1006634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae16376Open in IMG/M
Ga0136160_1006801All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha4922Open in IMG/M
Ga0136160_1007654Not Available5257Open in IMG/M
Ga0136160_1008757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum7552Open in IMG/M
Ga0136160_1009151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota5811Open in IMG/M
Ga0136160_1009270Not Available6561Open in IMG/M
Ga0136160_1010286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Phylloxeroidea → Phylloxeridae → Daktulosphaira → Daktulosphaira vitifoliae7667Open in IMG/M
Ga0136160_1010674Not Available12469Open in IMG/M
Ga0136160_1012207All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae7841Open in IMG/M
Ga0136160_1013127Not Available2762Open in IMG/M
Ga0136160_1013621Not Available3920Open in IMG/M
Ga0136160_1014947Not Available3520Open in IMG/M
Ga0136160_1015871Not Available6799Open in IMG/M
Ga0136160_1016020All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora565Open in IMG/M
Ga0136160_1016213Not Available8175Open in IMG/M
Ga0136160_1016558All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1820Open in IMG/M
Ga0136160_1017326All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora873Open in IMG/M
Ga0136160_1017482Not Available18987Open in IMG/M
Ga0136160_1018429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota5670Open in IMG/M
Ga0136160_1019005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae15019Open in IMG/M
Ga0136160_1020242Not Available6239Open in IMG/M
Ga0136160_1020247All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis4450Open in IMG/M
Ga0136160_1020403All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2837Open in IMG/M
Ga0136160_1020522All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora13682Open in IMG/M
Ga0136160_1020620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1808Open in IMG/M
Ga0136160_1021392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum9666Open in IMG/M
Ga0136160_1022083All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora8537Open in IMG/M
Ga0136160_1022280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum5564Open in IMG/M
Ga0136160_1024876All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum3008Open in IMG/M
Ga0136160_1028554Not Available1185Open in IMG/M
Ga0136160_1029270All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1877Open in IMG/M
Ga0136160_1031704All Organisms → cellular organisms → Eukaryota → Opisthokonta5984Open in IMG/M
Ga0136160_1031777All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae1614Open in IMG/M
Ga0136160_1033260All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2610Open in IMG/M
Ga0136160_1035161Not Available2622Open in IMG/M
Ga0136160_1035503All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae3036Open in IMG/M
Ga0136160_1035930All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora4500Open in IMG/M
Ga0136160_1037847All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum4011Open in IMG/M
Ga0136160_1038113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Schizaphis → Schizaphis graminum4441Open in IMG/M
Ga0136160_1038336All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Rhopalosiphum → Rhopalosiphum maidis1707Open in IMG/M
Ga0136160_1038437All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae3768Open in IMG/M
Ga0136160_1038478Not Available1525Open in IMG/M
Ga0136160_1038510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Diuraphis → Diuraphis noxia3261Open in IMG/M
Ga0136160_1038562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines2601Open in IMG/M
Ga0136160_1039637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3891Open in IMG/M
Ga0136160_1040347All Organisms → cellular organisms → Eukaryota → Opisthokonta5677Open in IMG/M
Ga0136160_1041326Not Available7087Open in IMG/M
Ga0136160_1044836All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini7047Open in IMG/M
Ga0136160_1044853Not Available5456Open in IMG/M
Ga0136160_1052074Not Available6879Open in IMG/M
Ga0136160_1053167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Chaitophorinae → Sipha → Sipha flava2492Open in IMG/M
Ga0136160_1053773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3884Open in IMG/M
Ga0136160_1054815Not Available1136Open in IMG/M
Ga0136160_1055182All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha2337Open in IMG/M
Ga0136160_1055248All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae2216Open in IMG/M
Ga0136160_1056798Not Available923Open in IMG/M
Ga0136160_1059841All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1212Open in IMG/M
Ga0136160_1060201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3098Open in IMG/M
Ga0136160_1060785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1666Open in IMG/M
Ga0136160_1062546Not Available3347Open in IMG/M
Ga0136160_1063684All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3134Open in IMG/M
Ga0136160_1064360All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3709Open in IMG/M
Ga0136160_1064508All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha5886Open in IMG/M
Ga0136160_1065647All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora799Open in IMG/M
Ga0136160_1066027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3174Open in IMG/M
Ga0136160_1067375All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha3019Open in IMG/M
Ga0136160_1067838All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1132Open in IMG/M
Ga0136160_1068020Not Available1217Open in IMG/M
Ga0136160_1070272Not Available1695Open in IMG/M
Ga0136160_1072200Not Available763Open in IMG/M
Ga0136160_1073050All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha4626Open in IMG/M
Ga0136160_1073520All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2116Open in IMG/M
Ga0136160_1075617All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2130Open in IMG/M
Ga0136160_1076755All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini5070Open in IMG/M
Ga0136160_1078694All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora575Open in IMG/M
Ga0136160_1080002Not Available1857Open in IMG/M
Ga0136160_1081591Not Available1058Open in IMG/M
Ga0136160_1081627All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1366Open in IMG/M
Ga0136160_1082743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2486Open in IMG/M
Ga0136160_1084941All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora647Open in IMG/M
Ga0136160_1085931Not Available1412Open in IMG/M
Ga0136160_1088569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1557Open in IMG/M
Ga0136160_1089650Not Available9851Open in IMG/M
Ga0136160_1090099All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1039Open in IMG/M
Ga0136160_1091615All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3750Open in IMG/M
Ga0136160_1091941All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora721Open in IMG/M
Ga0136160_1092532All Organisms → cellular organisms → Eukaryota → Opisthokonta1152Open in IMG/M
Ga0136160_1092798Not Available577Open in IMG/M
Ga0136160_1093123All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae941Open in IMG/M
Ga0136160_1093886Not Available799Open in IMG/M
Ga0136160_1094829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2610Open in IMG/M
Ga0136160_1096343All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3558Open in IMG/M
Ga0136160_1101271All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora510Open in IMG/M
Ga0136160_1103219Not Available639Open in IMG/M
Ga0136160_1103894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2389Open in IMG/M
Ga0136160_1104504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora4615Open in IMG/M
Ga0136160_1104640Not Available3026Open in IMG/M
Ga0136160_1107447Not Available640Open in IMG/M
Ga0136160_1108184Not Available2353Open in IMG/M
Ga0136160_1109481Not Available1095Open in IMG/M
Ga0136160_1111061Not Available628Open in IMG/M
Ga0136160_1111341All Organisms → Viruses → Predicted Viral3265Open in IMG/M
Ga0136160_1111902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora801Open in IMG/M
Ga0136160_1112287All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1991Open in IMG/M
Ga0136160_1117942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2472Open in IMG/M
Ga0136160_1122819Not Available983Open in IMG/M
Ga0136160_1124260All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1398Open in IMG/M
Ga0136160_1127247All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines735Open in IMG/M
Ga0136160_1133703Not Available3975Open in IMG/M
Ga0136160_1139741All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2946Open in IMG/M
Ga0136160_1145066All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae764Open in IMG/M
Ga0136160_1147844All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum5752Open in IMG/M
Ga0136160_1151362All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1509Open in IMG/M
Ga0136160_1156512All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini591Open in IMG/M
Ga0136160_1158422Not Available1170Open in IMG/M
Ga0136160_1158803Not Available610Open in IMG/M
Ga0136160_1160899Not Available577Open in IMG/M
Ga0136160_1164972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1971Open in IMG/M
Ga0136160_1166435Not Available549Open in IMG/M
Ga0136160_1170860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3098Open in IMG/M
Ga0136160_1176357Not Available732Open in IMG/M
Ga0136160_1179625Not Available570Open in IMG/M
Ga0136160_1179760All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1833Open in IMG/M
Ga0136160_1181197Not Available1157Open in IMG/M
Ga0136160_1182134All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae3832Open in IMG/M
Ga0136160_1187027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora653Open in IMG/M
Ga0136160_1187822Not Available506Open in IMG/M
Ga0136160_1189221All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae833Open in IMG/M
Ga0136160_1189604Not Available686Open in IMG/M
Ga0136160_1193912Not Available1129Open in IMG/M
Ga0136160_1198518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora778Open in IMG/M
Ga0136160_1203450Not Available840Open in IMG/M
Ga0136160_1204974All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora862Open in IMG/M
Ga0136160_1207261Not Available518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136160_1002693Ga0136160_10026931F029983MSLCCTVGHKRVTVMDGVKFEFNDIISLYKKDDSERKRS
Ga0136160_1002736Ga0136160_10027365F029983MSLCCTVGYKWVSVFIMDFIKFELNDIISLYNKNDSERRWFV
Ga0136160_1003169Ga0136160_10031691F029983MSLCCTVGHKWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1003925Ga0136160_10039254F029983MSLCCTVGYKWVTEMDGVKFEFNDIISLYKKNDSERKRSVSL*Y
Ga0136160_1004925Ga0136160_10049251F029983MSLCCAVGYK*VTVMDGIKFKFNDIISLYKKTDPERKRPVSL*N
Ga0136160_1005155Ga0136160_10051559F029983MPLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1005570Ga0136160_10055701F029983MSLCCTVGYKGVTVMDGVKFEFNDIISLYKKNGSERKR
Ga0136160_1006194Ga0136160_10061941F029983MSLCCTVGDKWVTEMDGEFNDIILLLHKKNDSERKRSVSL*
Ga0136160_1006634Ga0136160_100663413F029983MSLCCTVGYKWATVMDGVKFEFNDIISLYKKNDSERKQ
Ga0136160_1006801Ga0136160_10068014F029983MSICCTVGYKWVTVKDGVKFEFNDIISLYKKSDSERKRSVSL
Ga0136160_1007654Ga0136160_10076541F029983MSLCCTVDYKWVTVMDSVKVEFNDIPDISLYKKNDSERKRS
Ga0136160_1008757Ga0136160_10087571F029983MSLRCTVGYKLVNVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1009151Ga0136160_100915110F029983MSLYCTVGYKWVTVMDGVKFEFNDIISLYKKNDAE
Ga0136160_1009270Ga0136160_10092701F029983MSLCCTVGDKWVTVKDGVKFEFNDIISLYKKNDSERKRSVNL*
Ga0136160_1010286Ga0136160_10102866F029983MSLCCTVGYTWVTVMDGVKFEFNDIISLYQKNDSER
Ga0136160_1010674Ga0136160_10106741F029983MSLCFTVGYKGVTVMDGVKFEFNDIISLYKKNGSERKR
Ga0136160_1012207Ga0136160_10122075F029983MSLCCTVGDKWVTVINGVKFEFNDIISLYKKNDSERSR
Ga0136160_1013127Ga0136160_10131271F029983MSLCCTVGYKWLTVMNGVKFEFNDIILLYKKNDYDRKRSVS
Ga0136160_1013621Ga0136160_10136211F029983MSLC*TVGYKWVTVMDGVKFESNDIKSLYKKNDSER
Ga0136160_1014947Ga0136160_10149471F029983MSLCCIVGHK*VTAMDGVKFESNGIISLYKKIDSER
Ga0136160_1015871Ga0136160_10158714F029983MSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSE
Ga0136160_1016020Ga0136160_10160201F029983VDYKWVTVMDGVKFEFNDIISLYKKNDSERKLSVGL*
Ga0136160_1016213Ga0136160_10162134F029983MSLCYTVGYKWFAVMDGVKFEFNDIISIYKKNDSERKRSVSL*
Ga0136160_1016558Ga0136160_10165582F029983MSLCCTLGYKWVTVMDGVKFDINDIISLYKKTILT
Ga0136160_1017326Ga0136160_10173261F029983MSLCCTVGYKWVTAIDGVKFEFNDIISLYKKNDSERKRSVRL*C
Ga0136160_1017482Ga0136160_10174827F029983MSLCCTVGCKWVTAVMDGVKFEFNDIISLYKQNDSERNLSVR
Ga0136160_1018429Ga0136160_10184294F029983MSLCCTVGYKWDTVMDGVTFEFNDIISLYKKNDSERRRLYNITKYI*
Ga0136160_1019005Ga0136160_10190051F029983MDKWVSLCCTVGYKWVTVIDSVKLEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1020242Ga0136160_10202421F029983MSLCCTVGYRWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1020247Ga0136160_10202473F029983MSLCCTVGYKWIIVIYGVKFEFNDIISLYKKNGSE*KTVT
Ga0136160_1020403Ga0136160_10204031F029983MSLCCTVGYKWVSVTDDVKFEFNDIISLYKKNDSKR
Ga0136160_1020522Ga0136160_10205225F029983MSLCCRLGYKKVTAMDGVKFEFNDIISLYKIKDSERKRP
Ga0136160_1020620Ga0136160_10206201F029983MSLCCTVGYKWVTVMNGVKFEFNDIISLYKKNDSERKRSVSL*YY
Ga0136160_1021392Ga0136160_10213924F029983MSFCCTVDFKCVTEMYGFKFEFNDIISLYTKNDSERRRFISQGYFILKM*
Ga0136160_1022083Ga0136160_10220835F029983MSLCCTVGYKWVTVMDSIKFEFNDIISLYKKNDSERKRLVSLLY
Ga0136160_1022280Ga0136160_10222801F029983MSLCCTVGDKWVIVMDGVEFEFNDIIPLYKKNDSERKRSVSL*
Ga0136160_1024876Ga0136160_10248761F029983CCTVSYMWLTVMNDVKFELNDIISLYKKNDSERRWPESLGYY*
Ga0136160_1028554Ga0136160_10285541F029983VSLCCTVGYNWVTVMDGVKFEFNDIISLYKINDSEQKR
Ga0136160_1029270Ga0136160_10292701F029983MSLCCTVGYKWDTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_1031704Ga0136160_10317041F029983MMKKVGKWMSLFCTVGYKWATVMDGVKFEFNDIISLYKKNDSERKQ
Ga0136160_1031777Ga0136160_10317771F029983MSLCFIVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*YYQVYLMI
Ga0136160_1033260Ga0136160_10332602F029983MSLCCTVGYKWVTVMDGVKFEFNNIILSLYKKNDSEQKRSVSL*YYQVYLM
Ga0136160_1035161Ga0136160_10351611F029983MSLCCTVGDKCVTVMDGVKFEFNDIISLYKKNDSK*K
Ga0136160_1035503Ga0136160_10355031F029983VGKGMSLCCTVGHKWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1035930Ga0136160_10359301F029983MSLCCTVGYKWVTVMDCVKFEFNDIISLYKKTDSERKR
Ga0136160_1037847Ga0136160_10378476F029983VSLRCTEVYKWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1038113Ga0136160_10381131F029983MSLYYKVGYKWVTVMYGVKFEFNDIISLYKKNDSERKRSVSL*YY
Ga0136160_1038336Ga0136160_10383362F029983MSLCCTVGYKWVTVMDGIRIEFNDIISLYKKNDFERKRSVSL*
Ga0136160_1038437Ga0136160_10384372F029983MSLCCTVGYKWVTVMAGIKFEFNDISLYIKNNSER*
Ga0136160_1038478Ga0136160_10384781F029983MSLYCIVGYKWVTVMDNVKFEFNDIISLYKKNDSERKQSVSL*YYKVY
Ga0136160_1038510Ga0136160_10385103F029983MSLCCTVGYKWVAVMDGVEFEFNDIISLHTKNDSER*
Ga0136160_1038562Ga0136160_10385623F029983MSLCCTVGYKRVTVMDGVKFEFYDIIYLHKKKDSERKR
Ga0136160_1039637Ga0136160_10396371F029983MSLYCTVGYKWVTIMDGVKFEFNDIISLYKKNDSKRKRSVRL*
Ga0136160_1040347Ga0136160_10403474F029983MSICCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_1041326Ga0136160_10413263F029983VGCIVGYKCVTVMDGVKFEFNDIISLYKKNGQSAYD
Ga0136160_1044836Ga0136160_10448361F029983MGKWMSPCCTVGYKWVTVMDGVKFEFNDIISLYKKND
Ga0136160_1044853Ga0136160_10448534F029983MPFCCTVGYKWVTVMDGVKFEFDDIISLYKKNDSE
Ga0136160_1052074Ga0136160_10520741F029983MSLCCTVYDKWVYVMDGVKFEFNDKISLYKKTDSERKRLASLCYNQVYL*
Ga0136160_1053167Ga0136160_10531671F029983MSLCCTVGYEWVTVMDGVKFEFNDIISLYKKNDSEQK
Ga0136160_1053773Ga0136160_10537731F029983MSLCCTVIDGVKFEFNDIISLYKTNDSERKRSVNL*Y
Ga0136160_1054815Ga0136160_10548151F029983MSLCCTVDDKWVTVMDGVKFEFNDIISSYKKNDSGRKR
Ga0136160_1055182Ga0136160_10551821F029983MSLCCTVGYKWFTVMDGVKFEFNDIISLYKKNDSERKRSVRL
Ga0136160_1055248Ga0136160_10552482F029983MSLYCTVGYKWVTIMDGVKFEFNDIISLYKKNDSERKRSVRL*
Ga0136160_1056798Ga0136160_10567981F029983MGKCVLLCCTVDYK*VTVIDCVKFEFNDISLYKKNDS
Ga0136160_1059841Ga0136160_10598411F029983MSLCCTVGYKWVTVMDGIKFKFNDIISLYKKTDPERKRPVSL*N
Ga0136160_1060201Ga0136160_10602011F029983MSLYCTVGDKWVTVMDGVKFDFNDIISLYKKNDSERKRSVRL*
Ga0136160_1060785Ga0136160_10607851F029983MSLCCTVGYKWVTVMDSVKVEFNDIPDISLYKKNDSERKRS
Ga0136160_1062546Ga0136160_10625462F029983VSLYCTVGYKWVTVMDGVKFEFNDIISLYKKNDAE
Ga0136160_1063684Ga0136160_10636841F029983MSLCYTVGYKWVTVMDGVKFELFDIISLYKKNDSERKRSVSL*
Ga0136160_1064360Ga0136160_10643601F029983MLLCCSVGYKWVTIMDGVKFEFNDITSLGTKNASERRRFFSLDISYC
Ga0136160_1064508Ga0136160_10645081F029983MSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSAKT
Ga0136160_1065647Ga0136160_10656471F029983MSLCFTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_1066027Ga0136160_10660271F029983MSLCCTVGYKWVTLMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1067375Ga0136160_10673751F029983MSLCRMVGNKWVTVMDSVNFEFNDIISLYKKNDSERRRYVSLGKRT
Ga0136160_1067838Ga0136160_10678381F029983MSLCCTVGYKWVTVIDGVKFEFNDIISFYKKNDSERKR
Ga0136160_1068020Ga0136160_10680201F029983MSLCCTVGYK*VNVIDGVEFEFNDIKSLYKKNDSERRLSASL*
Ga0136160_1070272Ga0136160_10702721F029983VGKWVSFCCTVGYKWVTVMYGVKLKLNDIISWYKKNDSGRKRSV
Ga0136160_1072200Ga0136160_10722002F029983MSLCCKVGYNWVTVMDGVKFEFNDIIPLYKKNDSER
Ga0136160_1073050Ga0136160_10730505F029983MSLCYAVGYKWVTVMDGVQFEFNDIISLYKKNDSE
Ga0136160_1073520Ga0136160_10735201F029983VSLCCTVGYKWVSVKDGVKFKFNDLISLYTKNDSK
Ga0136160_1075617Ga0136160_10756171F029983MLLCCTVGYKRVTVMDCVKFEFNDIISLYKKNDQSAY
Ga0136160_1076755Ga0136160_10767555F029983MFLCFTVGYKWVIVMDGVKFEFNDIISLYTNNDSERRRFVSQGYLYCYF*
Ga0136160_1078694Ga0136160_10786941F029983KVGKWMSLCCTVGYKWVTVMDGVKFEFNDIMSLYKKNDSERKRSVSL*
Ga0136160_1080002Ga0136160_10800021F029983MSLCDTVGNKWVTVMDGVKFEFNDIISFYKKNESERKR
Ga0136160_1081591Ga0136160_10815911F029983MSLCCTVGYKWVTAVMDGVKFEFNDIISLYKQNDSERNLSVR
Ga0136160_1081627Ga0136160_10816271F029983MSLCCTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_1082743Ga0136160_10827431F029983MSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*C
Ga0136160_1084941Ga0136160_10849412F029983MSLCCTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1085931Ga0136160_10859311F029983MSLCCTVGDKWVIVMNGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1088569Ga0136160_10885691F029983MSL*CTVGDKWVTVMDGVKFEFNDRISLYKIYDSE*
Ga0136160_1089650Ga0136160_10896501F029983MSLCCTVDYK*VTVMDGVKFKFNDLISLYKKNDSER
Ga0136160_1090099Ga0136160_10900991F029983MSLCCTVGYKWVTIMDGVKFEFNDIISLYKKNDSERKRSVRL*C
Ga0136160_1091615Ga0136160_10916151F029983MSLCCTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1091941Ga0136160_10919411F029983MSLCCTVGYKWVTVMDDDKFEFNDIISLYKKNDSERK
Ga0136160_1092532Ga0136160_10925321F029983CTVGYKWVTVMDGVKFEFNDIISLYKKNDSERRRSVIL*
Ga0136160_1092798Ga0136160_10927981F029983VSKWISLCCTVGDKCVTVMGGVKFEFNDILSLYKKNDSERKQSLSL*YY
Ga0136160_1093123Ga0136160_10931232F029983MSICCTVGYKWDTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_1093309Ga0136160_10933091F029983MGKWVSLCCTEVNKRVTVMDGVKFEFNDIISLCKKNDSERKRS
Ga0136160_1093886Ga0136160_10938861F029983VDALLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDS
Ga0136160_1094829Ga0136160_10948291F029983MSLCCIVGYKWVTLMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1096343Ga0136160_10963433F029983VGKWMSLCCTVGYKWVTVMDGVKFEYNDIISLYKKNDSERKQSVSL*
Ga0136160_1101271Ga0136160_11012711F029983KMGKWMSLCCTVGYKWVTVMDGVKFEFNDTISLYTRNDFER*
Ga0136160_1103219Ga0136160_11032191F029983MAGKWMSLCCTVGYKWITVIGGVKFKFNDIISLYKKMILSENF
Ga0136160_1103894Ga0136160_11038941F029983VSFCCTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_1104504Ga0136160_11045042F029983MSLCCTIGYKWVTVMDGVKFEFNDIISLYKKNDSERKR
Ga0136160_1104640Ga0136160_11046401F029983MFLCYTLDYKWVTVMDGVKFEINYIMSLYKKNDSERKRSVNL*
Ga0136160_1107447Ga0136160_11074471F029983MSLCCTVSYKWINLIDGVKFEFNDIISLHKKNDSERKWSVN
Ga0136160_1108184Ga0136160_11081841F029983MSLCCTVDYKWVTAMDGVKFEFNDDIISLYKKKDSE*
Ga0136160_1109481Ga0136160_11094811F029983MNIWMSLFCTVGYKCVTVMDGVKFEFNDIISLYKKNGQSAYD
Ga0136160_1111061Ga0136160_11110612F029983VGKWVSLICTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1111341Ga0136160_11113411F029983VGKLVSLCYIIGYKWVTVMDGVKFEFNDIILSLYKKN
Ga0136160_1111902Ga0136160_11119021F029983MSRTNKKKWMSLCCTVGYKWVTVMDGVKFEYNDIISLYKKNDSERKQSVSL*
Ga0136160_1112287Ga0136160_11122871F029983MGKWMSLCCTVGCKWVIVMDGVKFEFNDILSLYKKNVQSAYD
Ga0136160_1117942Ga0136160_11179421F029983MMSLCCTVGCKWVTVMDGVKFEFNDIISLYKKNDSEQKRPVSLYYQVYFMILL*
Ga0136160_1122819Ga0136160_11228191F029983MPLCCTVGYKCVTVMDGVKFEFNDIISLYKKNGQSAYD
Ga0136160_1124260Ga0136160_11242602F029983VSKWTLFCCTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1127247Ga0136160_11272471F029983MSLCCTVGDKCVTVMGVVKFEFNDIISLYKKNDSERKRSVSL*YYQ
Ga0136160_1133703Ga0136160_11337031F029983MSLRCTVGYIWVTVMDGVKFELNDIISLYKKNDSERKRSVSL*
Ga0136160_1139741Ga0136160_11397411F029983MSLCCTVGSKWVTVMDGVKFEFNDIISMYTKKDSERRRIISL
Ga0136160_1145066Ga0136160_11450661F029983MSLCCTVGYKWVIVMDGVKFEFNDIISLYKKNDSERKRSDRL
Ga0136160_1147844Ga0136160_11478441F029983MTLCCTVGYKWVTIMDGVKFEINDMISLYKKNDSERKRSVNL*
Ga0136160_1151362Ga0136160_11513621F029983MGKWMSLCCTVGYKWDTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_1156512Ga0136160_11565121F029983VGKWISLCSTVGYEWVTVMDGVKFEFNDIISLYKKNDSEQK
Ga0136160_1158422Ga0136160_11584221F029983VDKWILLCCTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_1158803Ga0136160_11588031F029983MSLYCIVGYKWVTVMDGVKFKFNDIISLYKKNDSE
Ga0136160_1160899Ga0136160_11608991F029983MLLCCTVGYKWVTVMGVKFEFNDIISLYKKNDSEQKRSVSL
Ga0136160_1164972Ga0136160_11649721F029983MKKSGKWMSLSCTVGYKWVTVMDCIKSESLYKKNDF
Ga0136160_1166435Ga0136160_11664351F029983MSLCCAVGDKWVTVMDGVKFEFNDIISLYKKKRF*
Ga0136160_1170860Ga0136160_11708601F029983MSLCCTVGYKWVTVIDGVKFKFNDIISLYKKDDSERKRSVR
Ga0136160_1176357Ga0136160_11763572F029983MSLCCTVGYKWVTVMNGVTFEFNDIISLYKKNDFERKRSVSLW
Ga0136160_1179625Ga0136160_11796251F029983CCTVGYKWVTVMDGVKFEFNDIISLYKKSDSERKRSVSL*
Ga0136160_1179760Ga0136160_11797601F029983VSLCCTEVYKWATIMDGVKFEFNDIISLYKKNDSERKRSVRL
Ga0136160_1181197Ga0136160_11811971F029983VSLCCTVGYKWATVMDGVKFEFNDIISLYKKNDSERKQ
Ga0136160_1182134Ga0136160_11821341F029983VGKWISLCCAVGYKWVTVIDDVKFEFNDIKSLYKKND
Ga0136160_1187027Ga0136160_11870271F029983MSLCCTVGYKWITVMDGVKFEFNDIISLYKKNDSE
Ga0136160_1187822Ga0136160_11878221F029983VLLCCTVGYKWITVMDGVTFEFNDIISLYMKHDSER*
Ga0136160_1189221Ga0136160_11892213F029983VGKWVSLCCTVGYKWVTVMDGVKFEFNDIISLYKKND
Ga0136160_1189604Ga0136160_11896041F029983MSLFWTVDDKWVTVMDGVKFEFNDIISSYKKNDSGRKR
Ga0136160_1193912Ga0136160_11939121F029983MLLCCKIGFKWVTVMDGVKFEFNDLISLYKKK*I*M
Ga0136160_1198518Ga0136160_11985181F029983MSLCCTAVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_1203450Ga0136160_12034501F029983MSL*CTVGYKWVTVMDGVKFEFNNIISLYKKNANINI
Ga0136160_1204974Ga0136160_12049741F029983VGKWISLCCKVGYKWVTVMDGVKFEFNDLISLYKINDS
Ga0136160_1207261Ga0136160_12072611F029983MSLCCTEGYKWFTVMDGVKFEFNDIISLYNKNDSERKRSVSQPMI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.