Scaffold Ga0136160_1016020

Overview

Basic Information

• Taxon OID: 3300010225
• Scaffold ID: Ga0136160_1016020
• Source Dataset Name: Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DNAVision
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1

Source Dataset Sampling Location

• Location Name: Shanxi Taiyuan, China
• Coordinates
  • Lat. (^o): 37.87
  • Long. (^o): 112.54

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136160_10160201	F029983	N/A	VDYKWVTVMDGVKFEFNDIISLYKKNDSERKLSVGL*