Scaffold Ga0136160_1009151

Overview

Basic Information

• Taxon OID: 3300010225
• Scaffold ID: Ga0136160_1009151
• Source Dataset Name: Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DNAVision
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5811
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1

Source Dataset Sampling Location

• Location Name: Shanxi Taiyuan, China
• Coordinates
  • Lat. (^o): 37.87
  • Long. (^o): 112.54

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136160_100915110	F029983	GGTGG	MSLYCTVGYKWVTVMDGVKFEFNDIISLYKKNDAE