NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136257_132112

Scaffold Ga0136257_132112


Overview

Basic Information
Taxon OID3300010222 Open in IMG/M
Scaffold IDGa0136257_132112 Open in IMG/M
Source Dataset NameHalite microbial communities from Salar Grande, Atacama Desert, Chile, 2013
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1372
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Geologic → Unclassified → Unclassified → Evaporite → Halite Endoliths Microbial Communities Diversity Study

Source Dataset Sampling Location
Location NameSalar Grande, Atacama desert, Chile
CoordinatesLat. (o)-21.0011111Long. (o)-70.07138889Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027696Metagenome194N

Sequences

Protein IDFamilyRBSSequence
Ga0136257_1321123F027696GAGGMSTTQLNTVAANLDISEHDGERVIDFDIAANTDYEIQSCVMVDEDNRVVEAAVRFGRVEERDHLGIGKPILASAWSNMVSKVTGAEAVEGDLSDFSHIVPHLRVHRENVEEYGLETLSLD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.