Scaffold Ga0136220_1018024

Overview

Basic Information

• Taxon OID: 3300010219
• Scaffold ID: Ga0136220_1018024
• Source Dataset Name: Soil microbial communities from Bangor area, North Wales, UK, before enrichment, after WGA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Fidelity Systems Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 838
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location

• Location Name: Bangor area, North Wales, UK
• Coordinates
  • Lat. (^o): 53.24
  • Long. (^o): -4.01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078325	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136220_10180242	F078325	N/A	XEGLEDRLLQAELLREFGQTSRALGNSADARLAWSEAAESFEDVGAQHEAAEINALLSSLPS*